Supplemental Fig. S1. Nishimura et al. PMB

Oct 30, 2014

10 likes | 98 Views

Supplemental Fig. S1. Nishimura et al. PMB. A. RlemMT1. B. RlemMT2.

Share Presentation

Embed Code

Link

david-manning

Download Presentation

Supplemental Fig. S1. Nishimura et al. PMB

An Image/Link below is provided (as is) to download presentation Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author. Content is provided to you AS IS for your information and personal use only. Download presentation by click this link. While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server. During download, if you can't get a presentation, the file might be deleted by the publisher.

E N D

Presentation Transcript

Supplemental Fig. S1. Nishimura et al. PMB A RlemMT1 B RlemMT2

Lim et al, Supplemental Figure S1.

Lim et al, Supplemental Figure S1. . a/b. a. a. b/c. a/b. c/d. c/d. c/d. d. e. Arsenic. Plant height (Cm). f. g. [mg/Kg]. 1.5. 5.0. 7.0. 0. 10. 50. 100. 150. 0. 200. 300. 400. 500. 0. As[ μ M]. Cadmium. a/b. a. b. b. c. c. d. d. d/e. e. f. g.

178 views • 5 slides

Supplemental data Fig. S1

Supplemental data Fig. S1.

162 views • 4 slides

Tholen et al ., Sup . Fig. S1

Tholen et al ., Sup . Fig. S1. Tholen et al ., Sup . Fig. S2. A. B. C. Tholen et al ., Sup . Fig. S3. A. B. No . of proteins identified. No . of proteins identified. C. D. No . of proteins identified. No . of proteins identified. Tholen et al ., Sup . Fig. S4.

137 views • 6 slides

Supplemental Fig. S1

extracellular (P=0.000) cell wall (P=0.000) ribosome (P=0.001) ER (P=0.294) golgi apparatus (P=0.005) plasma membrane (P=0.000) mitochondria (P=0.000) cytosol (P=0.553) other cellular components (P=0.000) nucleus (P=0.000) other membranes (P=0.970) plastid (P=0.000)

272 views • 12 slides

Supplemental Fig. S2. Nishimura et al. PMB

Supplemental Fig. S2. Nishimura et al. PMB.

105 views • 1 slides

Fig. S1; Ritter et al. 2010

Relative induction of p-Erk1. Relative induction of p-IRAK1. Relative induction of p-RAF. Relative induction of p-Erk2. Relative induction of p-MKK6/3. Relative induction of p-MEK1/2. Fig. S1; Ritter et al. 2010. Relative induction of p-ELK. Relative induction of p-RSK.

186 views • 3 slides

Yoon et al. Supplemental Figure S1

Yoon et al. Supplemental Figure S1. A. B. AGS. MKN-45. N87. CFPAC-1. PANC-1. AGS. MKN-45. N87. CFPAC-1. PANC-1. Monolayer. Monolayer. Monolayer. Monolayer. Monolayer. Monolayer. Monolayer. Monolayer. Monolayer. Monolayer. Spheroid. Spheroid. Spheroid. Spheroid.

131 views • 1 slides

Miao et al., Fig. S1

Miao et al., Fig. S1.

159 views • 7 slides

Supplemental Fig. S1

Supplemental Fig. S1. a). b). PsAPY1 (AB071369) 1:MEFLIKLIT-FLLFSMPAITSSQYLGNNLLTSRKIFLKQEEISSYAVVFDAGSTGSRIHV 59 MtAPY1;1 (AY180377) 1:MEFLITLITTVLLLLMPAITSSQYLGNNLLTNRKIFQKQETISSYAVVFDAGSTGSRIHV 60 ***** *** ** **************** **** *** *******************

127 views • 3 slides

Supplemental FIG. S1

Supplemental FIG. S1. 1387 CAGUGCUUUAACUCUGUGCA UCACACUUGUCCUUUAAAUG 1427 GAGACUGUAAGCUUUUAUGA ACUUUUUUUACUUGGACACC 1467 ACUUUUACACAAAGUAUUUU GAAACAAAAGGCUAUAGGAA 1507 ACAUGAAAAGGUCAAAUGAU CAUUAUGCUGCUAUGGAGGA 1547 UGCUACUUGAUGGAGAUCAG CUGCUCGGGGCCAAGAAAAA

97 views • 1 slides

Lim et al, Supplemental Figure S1.

Lim et al, Supplemental Figure S1. OsRING-H2 type : 4 OsRING-HC type : 6 OsRING-v type : 2. OsRING-H2 type : 5 OsRING-HC type : 1 OsRING-v type : 1. OsRING-H2 type : 9 OsRING-HC type : 8 OsRING-v type : 2. OsRING-H2 type : 9 OsRING-HC type : 8 OsRING-v type : 2.

225 views • 14 slides

Supplemental Fig. S1 Awano et al

*. 0.10. D272NRNase R. 0.08. D280NRNase R. D. CsdA-. C. 0.06. Fraction unwound. 0.04. 0.02. 0.00. 0. 5. 10. 15. 20. 25. Time (min). Supplemental Fig. S1 Awano et al. A. CsdA- D C. RNase R-WT. D272NRNase R. D278NRNase R. D280NRNase R. Time (min).

120 views • 2 slides

Fig. S1. Ki et al .,

Amino acid sequences of the variable heavy chain of clec14a-CTLD IgGs. Amino acid sequences of the variable light chain of clec14a-CTLD IgGs. Fig. S1. Ki et al .,.

98 views • 1 slides

Pathiraja, et al. Supp. Fig. S1

Pathiraja, et al. Supp. Fig. S1. TRIM24 expression in TCGA BRCA. A. B. Top 30% vs. Bottom 70%. p-value : 1.32e-07. log2 FC (Invasive carcinoma/normal). p-value : 1.46e-08; Odds ratio : 0.43. p-value : 0.047; odds ratio : 1.40. p-value : 3.8e-04; Odds ratio : 1.98. Paired Samples.

192 views • 6 slides

Fig. S1. Weng et al.

Relative ELISA titer (%). Fig. S1. Weng et al. 1b 1a 2a. HCR6 RdRp. H77 RdRp. JFH1RdRp. GST-L245A/I253A. A242C/S244D. A238S/Q248E. J6CF RdRpwt. Protein marker. RMT RdRpwt. Con1 RdRpwt. NN RdRpwt. A242C. S244D.

152 views • 5 slides

Fig. S1. (Zhu et al.)

Day 6 T cells. Donor-1. Donor-2. - + - +. - + - +. Roc-A:. - - + +. - - + +. PMA/iono.:. p-JNK-1 -. p-JNK-2 -. JNK-1 -. Fig. S1. (Zhu et al.).

98 views • 1 slides

Supplemental figures Fig S1

Supplemental figures Fig S1. Fig S2.

156 views • 1 slides

Fig. S1 . Lee. et. al.

130 views • 1 slides

Fig. S1 . Okubo et al.

a. b. c. d. e. g. f. h. i. k. j. l. Fig. S1 . Okubo et al. a. c. b. d. e. g. f. h. i. j. k. l. Fig. S2 . Okubo et al. a. c. b. d. e. g. f. h. i. j. k. l. Fig. S3 . Okubo et al. a. d. b. c. g. h. e. f. k. i. j. l. Fig. S4 . Okubo et al. a. c. d.

146 views • 6 slides

Teng et al. Fig. S1

Teng et al. Fig. S1. D ssa1. D dnm1. D ssa2. D ssa1. D dnm1. D ssa2.

96 views • 1 slides

Kuwano et al., Supplemental Figure S1

A. 5’UTR. CR. 3’UTR. MKP-1. 1. 249. 2015. 1352. CR. 3’UTR. 5’UTR. MKP-1. GAPDH. B. 5’UTR CR 3’UTR 3’UTR. RNA :. H 2 O 2 (h) : 0 1 2 0 1 2 0 1 2 0 1 2. HuR NF90.

160 views • 6 slides

Supplemental Fig. S1 Koma et al.

M. M. CFE. CFE. PF. PF. 114,000. 114,000. 84,700. 84,700. 47,300. 47,300. 31,300. 31,300. MJ1008. TTE0933. TTHA0124. M. CFE. PF. (Da). (Da). (Da). 114,000. 84,700. 47,300. 31,300. Supplemental Fig. S1 Koma et al.

152 views • 1 slides

More Related