slide1 n.
Download
Skip this Video
Loading SlideShow in 5 Seconds..
Susu PowerPoint Presentation
Download Presentation
Susu

Loading in 2 Seconds...

  share
play fullscreen
1 / 35
rebekah-conrad

Susu - PowerPoint PPT Presentation

425 Views
Download Presentation
Susu
An Image/Link below is provided (as is) to download presentation

Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author. While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server.

- - - - - - - - - - - - - - - - - - - - - - - - - - - E N D - - - - - - - - - - - - - - - - - - - - - - - - - - -
Presentation Transcript

  1. Susu Erry Yudhya Mulyani, M.Sc

  2. SIFAT FISIK, KIMIA DAN MUTU SUSU  susu merupakan media yang baik sekali bagi pertumbuhan mikrobia sehingga apabila penanganannya tidak  baik akan dapat menimbulkan penyakit yang berbahaya (“zoonosis”).

  3. DEFINISI: • SEKRESI NORMAL DARI KELENJAR • MAMAE DARI HEWAN YG MENYUSUI • SUMBER: • SAPI • KAMBING • KERBAU • DOMBA • UNTA • KUDA

  4.  Sifat Fisik Susu : WARNA Warna air susu dapat berubah dari satu warna kewarna yang lain, tergantung dari bangsa ternak, jenis pakan, jumlah lemak, bahan padat dan bahan pembentuk warna. Warna air susu berkisar dari putih kebiruan hingga kuning keemasan. Warna putih dari susu merupakan hasil  dispersi dari refleksi cahaya oleh globula  lemak dan partikel koloidal dari  casein dan calsium phosphat. Warna kuning adalah karena lemak dan caroten yang dapat larut.  Bila lemak diambil dari susu maka susu akan menunjukkan warna kebiruan.

  5. Air susu terasa sedikit manis, yang disebabkan oleh laktosa, sedangkan rasa asin berasal dari klorida, sitrat dan garam-garam mineral lainnya. (biasanyatawartetapisedikitmanis untukkebanyakanorang) Rasa dan bau air susu  (Buckle et al.,1987) menyatakan bahwa cita rasa   yang kurang normal mudah sekali berkembang di dalam  susu

  6. a. Sebab-sebab fisiologis seperti cita rasa pakan sapi misalnya bawang merah, bawang putih, dan cita rasa  algae yang akan masuk  ke dalam susu jika bahan-bahan itu mencemari pakan dan air minum sapi. b. Sebab-sebabvdari enzim yang  menghasilkan cita rasa tengik karena kegiatan      lipase pada lemak susu. Cita rasa mudah berubah dikarenakan: Sebab-sebab kimiawi, yang disebabkan oleh oksidasi lemak. Sebab-sebab fisiologis seperti cita rasa pakan sapi misalnya bawang merah, bawang putih, dan cita rasa  algae yang akan masuk  ke dalam susu jika bahan-bahan itu mencemari pakan dan air minum sapi. Sebab-sebab dari enzim yang  menghasilkan cita rasa tengik karena kegiatan lipase pada lemak susu. Sebab-sebab dari bakteri yang timbul sebagai akibat pencemaran dan pertumbuhan bakteri  yang menyebabkan peragian laktosa menjadi asam laktat dan hasil samping metabolik lainnya yang mudah menguap.   Sebab-sebab mekanis, bila susu mungkin menyerap cita rasa cat yang ada disekitarnya, sabun dan dari larutan chlor

  7. Berat  jenis harus  ditetapkan  3 jam setelah air susu diperah. Penetapan lebih awal akan menunjukkan hasil BJ yang lebih kecil. Hal ini disebabkan oleh : a.¾  perubahan kondisi lemak b.   ¾  Adanya gas yang timbul didalam air susu   Berat jenis air susu : Air susu mempunyai berat jenis yang lebih besar daripada air. BJ air susu = 1.027-1.035 dengan rata-rata 1.031 menurut codex susu, BJ air susu adalah 1.028. Codex susu adalah suatu daftar  satuan yang harus dipenuhi air susu sebagai bahan makanan. Berat  jenis harus  ditetapkan  3 jam setelah air susu diperah. Penetapan lebih awal akan menunjukkan hasil BJ yang lebih kecil. Hal ini disebabkan oleh : a.       ¾  perubahan kondisi lemak b.   ¾  Adanya gas yang timbul didalam air susu

  8.   Kekentalan air susu (viskositas) BJ maka viskositas air susu lebih tinggi daripada air. Viskositas air susu biasanya berkisar 1,5 – 2,0 cP.  Pada suhu 20°C viskositas whey 1,2 cP, viskositas susu skim 1,5 cP dan susu segar 2,0 cP.

  9. Pada codex air susu dicantumkan bahwa titik beku air susu adalah –0.5000 C. Akan tetapi untuk Indonesia telah berubah menjadi –0.5200 C. Titik beku air adalah 00 C. Titik beku dan titik cair dari air susu : campuran air susu dengan air akan memperlihatkan titik beku yang lebih  besar dari  air dan  lebih kecil dari air susu. Titik didih air adalah 100°C  dan air susu 100.16°C.

  10. Daya cerna air susu : Air susu mengandung bahan/zat makanan yang secara totalitas dapat dicerna, diserap dan dimanfaatkan tubuh dengan sempurna atau 100%. Oleh karena itu air susu dinyatakan sangat baik sebagai bahan makanan.

  11. Sifat Kimia Susu : Keasaman dan pH Susu :  susu segar mempunyai sifat ampoter, artinya  dapat bersifat asam dan basa sekaligus.   Jika diberi kertas lakmus biru, maka warnanya akan menjadi merah, sebaliknya jika diberi kertas lakmus  merah warnanya  akan berubah menjadi biru. 

  12. Potensial  ion hydrogen (pH) susu  segar  terletak antara 6.5 –  6.7.  Jika dititrasi dengan alkali dan kataliasator penolptalin, total asam dalam susu diketahui hanya 0.10 – 0.26 %  saja. Sebagian besar asam yang ada dalam susu adalah asam laktat Meskipun demikian keasaman susu dapat disebabkan oleh berbagai senyawa yang  bersifat asam seperti senyawa-senyawa pospat komplek, asam sitrat, asam-asam amino dan karbondioksida yang larut dalam susu. Bila nilai  pH air susu lebih tinggi dari 6,7 biasanya diartikan terkena mastitis dan bila pH dibawah 6,5  menunjukkan  adanya kolostrum ataupun pemburukan bakteri.

  13. KOMPOSISI ZAT GZI • MAJOR CONSTITUENTS: • 1. AIR : 87.25% • 2. BAHAN KERING • (TOTAL SOLID) : 12.75% • a. LEMAK : 3.80% • b. PROTEIN : 3.50% • c. GULA (LAKTOSA): 4.80% • d. ASH (MINERAL) : 0.65%

  14. KOMPOSISI ZAT GIZI B. MINOR CONSTITUENTS: 1. CAROTEN, PENYEBAB WARNA KUNING 2. PHOSPHOLIPIDS: LECHITIN, YAKNI ZAT SEPERTI LEMAK YG MENGANDUNG NITROGEN DAN PHOSFOR. BILA SUSU DIPISAHKAN MAKA LECHITIN TERDAPAT PADA KRIM (0.03%-0.05%) - DEKOMPOSISI DARI LECHITIN MENYEBABKAN TERBENTUK TMA YG DAPAT MENGHASILKAN BAU SEPERTI IKAN

  15. KOMPOSISI ZAT GIZI B. MINOR CONSTITUENTS: 3. KOLESTEROL: 105 – 176 PPM 4. ENZYM: GALAKTASE (ENZIM PROTEOLITIK), LIPASE DAN KATALASE 5. VITAMIN: A, B1, B2, NIACIN, B6, ASAM PANTOTENAT, C, D, E, DAN K

  16. KOMPOSISI ZAT GIZI BERBAGAI SUSU

  17. LEMAK • Bervariasi: 3.5 – 5.0, jarang < 2.5 atau > 6.0 • Lemak yg dipisahkan dari susu disebut KRIM • Krim (table use) mengandung lemak susu 18-25% • Krim dipadatkan jadi BUTTER (lemak 80-85%) • Butter oil atau dry butter mengandung 98 -99.5% lemak susu • Keju: 30 - 40% lemak • Eskrim : 8 – 20% lemak • Susu evaporasi: 8% lemak • Tepung susu (dry whole milk): 26% lemak • Lemak dlm susu merupakan GLOBULA yaitu emulsi O/W yg dapat dilihat dengan mikroskop

  18. LEMAK - Lapisan yang ada disekeliling globula lemak disusun oleh protein tertentu dan lecithin (jumlah sedikit) - Ukuran globula: 1 tetes lemak = 100 juta globula dan dipengaruhi : 1. jenis sapi: Jersey dan Guersey lebih besar dari Holstein dan Ayrshire 2. periode laktasi: pertama laktasi besar dan seterusnya kecil *Rata-rata kolesterol: 14 mg/100 g

  19. PENANGANAN SUSU • PENDINGINAN : 40 C • 2. HOLDING METHOD: 650 – 660C, 30 menit • 3. HTST: 720 C, 15 detik • 4. UHT : 1400 – 1500C, 1 – 2 detik

  20. PENYAKIT DITULARKAN DARI SUSU • ABORSI : Brucella abortus • Gejala: a. demam berselang-seling • b. banyak keringat • c. sakit kepala • d. badan sakit semua • LEPOTOSPIROSIS: Leptospira • Gejala: influenza dan gejala-gejala jenis typoid

  21. PENYAKIT DITULARKAN DARI SUSU • 3. TBC: Mycobacterium bovis • DEMAM Q (Q-FEVER): Coxiella burnetti • - ditularkan melalui udara • - penyakit seperti radang paru-paru • (pneumonia) • Dengan Pasteurisasi mikroba patogen pada • Susu dapat dihilangkan. • Pada tepung susu dapat ditemukan: • Spora Bacillus cereus

  22. PENENTUAN MUTU SUSU • UJI ALKOHOL • - campurkan sejumlah yg sama susu segar & ethanol • 68% dalam test tube • - kocok dan amati apakah ada koagulasi atau tidak • - contoh yg baik tidak ada koagulasi • 2. UJI FORMALIN • - isi tabung reaksi dgn 5 ml H2SO4 pekat dan • ditambahkan 2 tetes larutan FeCl3 10% • - melalui dinding tabung tuangkan perlahan-lahan • 5 ml susu segar • - lapisan pemisah antara asam dan contoh susu ter- • bentuk warna merah lembayung, formalin positif

  23. PENENTUAN MUTU SUSU 3. UJI BERAT JENIS - masukkan susu segar kedalam gelas ukur 1000 ml - masukkan HYDROMETER - baca skala yang ditunjukkan - Bj susu normal: 1.027 – 1.032 4. UJI GLOBULA - 1 tetes susu segar taruh kedalam deck glass - amati pada mikroskop pada perbesaran 10 x 10 dan 10 x 40 - globula memiliki bentuk bulat dengan jari-jari sama (ukuran < 2 mikron)

  24. PENENTUAN MUTU SUSU 5. UJI AMILUM - masukkansususegar 2 ml kedalamtabungreaksi - tambahkan 2 teteslarutan I2 0.5% dankocok - terbentukwarnabiru, amilumpositif 6. UJI METYLENE BLUE - 1 ml MB 2% masukkankedalamtestubesteril - tambahkan 10 ml sususegardankocok - hitungwaktuperubahandariwarnabirumenjadi warnaputih (4/5 bagiansudahputih) - tentukankualitassusuberdasarkanwaktureduksi MB menjadi MW

  25. Hubungan MBRT dgn mutu susu

  26. Hub. Jumlah koloni dgn MBRT

  27. KOMPOSISI LEMAK SUSU • Merupakan trigliserida: 1 molekul gliserol (C3H5(OH)3) dengan 3 molekul asam lemak • Asam lemak pada susu terdiri dari: • 1. asam lemak yg dpt larut (7.186%) • * rantai pendek: C4 – C 10 • * As. butirat, as. kaproat, as. kaprilat, as. kaprat • 2. Asam lemak yang tidak dapat larut (87.602%) • * As. laurat, as. myristat, as. palmitat, as. stearat • dan asam oleat (31.895%) • Asam butirat berperan dalam penentuan rasa dan dalam proses ketengikan • Asam oleat akan meningkat bila sapi makan rumput

  28. KOMPOSISI LEMAK SUSU • GOAT MILK CONTAIN A HIGHER • PERCENTAGE OF SMALL FAT WHICH IN • THEORY ARE MORE EASYLY BROKEN • DOWN BY DIGESTIVES ENZYMES • HAL YANG SAMA JUGA TERJADI BILA SUSU • SAPI DIHOMOGENISASI • DOKTER PADA ZAMAN HIPPOCRATES • MENGANJURKAN SUSU KAMBING PADA • BAYI KARENA MUDAH DICERNA (ALERGI • SUSU SAPI DAPAT DIBERI SUSU KAMBING)

  29. PROTEIN • Kandungannya: 2.8 – 4.0%, rata-rata: 3% • Terdiri dari: 1. CASEIN : 80% • 2. LACTALBUMIN : 18% • 3. LACTOGLOBULIN : 0.05-0.07% • 4. Sisanya NPN : FIBRIN • Keju cheedar mengandung protein : 33% • Keju requefort mengandung protein : 21% • Keju camembert mengandung protein: 19% • Keju lembek proteinnya rendah sebab kandungan air lebih tinggi ( protein: 12 – 20%)

  30. PROTEIN • Casein dpt diendapkan oleh asam, alkohol dan rennin tetapi pada suhu 1000C, 12 J terjadi pengedapan • Lactalbumin (albumin) mengadung sulfur tetapi tidak mengadung phosfor

  31. LAKTOSA • Rumus kimia: C12H22O11 • Ada dalam 2 bentuk yaitu: • 1. alpha • 2. beta (lebih mudah larut) • Kandungan dalam susu: 4.8 % • Jenis Jersey: 5%, Holstein: 4.6% • - terdapat pada WHEY • - Mudah dibusukkan oleh bakteri asam laktat • sehingga berasa asam: • C12H22O11 + H2O (+bakteri) --- 4C3H6O3 • As. laktat • 1 gram laktosa --- 0.8 gram as.laktat

  32. LAKTOSA • - berpengaruh dalam kelembutan eskrim yakni • SANDINESS: rasa berpasir bila makan eskrim • karena kristalisasi alpha laktosa • - pada cairan yang dipekatkan alpha yg kurang • larut dapat mengkristal sebagai hydrat • MENCEGAH SANDINESS: • Menurunkan jumlah laktosa dalam campuran • Eskrim • 2. Mengontrol seksama suhu penyimpanan • sesudah eskrim dibekukan

  33. LAKTOSA - Dapat terjadi “LACTOSE INTOLERANCE” karena tidak ada enzim laktase (Beta 1-4 galatosidase) sehingga menyebabkan diare - Mekanisme: Laktosa yg tidak dapat diserap masuk kedalam usus kecil dan cairan jadi banyak. Gula tsb masuk ke usus besar dan difermnetasikan oleh bakteri sehingga menghasilkan gas

  34. MINERAL • Sekitar 0.65%: • 1. banyak: K, Na, Ca, Mg, Cl, P, S • 2. sedikit : Fe, Cu, Zn, Al, Mn, Co, I2 • 3. trace : Si, boron, titanium, vanadium, • lithium dan stronsium • - Calsium dan Phosfor bergabung dgn protein

  35. VITAMIN • Vit. larut lemak lebih tinggi pada musim • summer karena makan rumput dan lebih • rendah pada winter karena pakan konsentrat • Skim milk rendah vit. Larut lemak • Susu merupakan sumber yg baik riboflavin • tetapi pada penyimpanan menurun karena • cahaya • Thiamin rusak pada pemanasan dan tertinggi • rusak pada UHT termasuk B6, B12 dan as. folat