the 7 bridges in k nigsberg and compositional representation of protein sequences l.
Skip this Video
Loading SlideShow in 5 Seconds..
The 7 Bridges in K ö nigsberg and Compositional Representation of Protein Sequences PowerPoint Presentation
Download Presentation
The 7 Bridges in K ö nigsberg and Compositional Representation of Protein Sequences

Loading in 2 Seconds...

play fullscreen
1 / 21

The 7 Bridges in K ö nigsberg and Compositional Representation of Protein Sequences - PowerPoint PPT Presentation

  • Uploaded on

The 7 Bridges in K ö nigsberg and Compositional Representation of Protein Sequences. Bailin Hao ( 郝柏林 ) (ITP & BGI, CAS ) Huimin Xie ( 谢惠民 ) ( Math Dept. Suzhou U ) Shuyu Zhang ( 张淑誉 ) (IP. Acad. Sinica). Compositional Approach in Prokaryote Phylogeny .

I am the owner, or an agent authorized to act on behalf of the owner, of the copyrighted work described.
Download Presentation

The 7 Bridges in K ö nigsberg and Compositional Representation of Protein Sequences

An Image/Link below is provided (as is) to download presentation

Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author.While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server.

- - - - - - - - - - - - - - - - - - - - - - - - - - E N D - - - - - - - - - - - - - - - - - - - - - - - - - -
Presentation Transcript
the 7 bridges in k nigsberg and compositional representation of protein sequences

The 7 Bridges in Königsberg and Compositional Representation of Protein Sequences

Bailin Hao (郝柏林)


Huimin Xie (谢惠民)

(Math Dept. Suzhou U)

Shuyu Zhang (张淑誉)

(IP. Acad. Sinica)

compositional approach in prokaryote phylogeny
Compositional Approach inProkaryote Phylogeny
  • Justification of using K-tuples instead of primary protein sequences.
  • Problem of uniqueness of reconstruction of protein sequence from its constituent K-tuples.
  • Picking up a special class of proteins without biological knowledge.
7 bridges in k nigsberg

7 bridges in Königsberg

Euler (1736)

4 odd nodes: No!

Dénes König, Theory of Finite and Infinite Graphs

1st ed.(1932). Birkhaüser (1990)

“ From Königsberg to König’s book, So runs the graphic tale…’’

basic notions
Basic Notions
  • A Graph G=(V, E), where V is a set of nodes (vertices), E is a set of edges (bonds)
  • Edges: undirected (u,v)=(v,u), uand v adjacent; directed (u,v) differs from (v,u), u incident to v.
  • A weight may beassociated with (u,v): cost, distance, transfer function, reaction rate, etc.
  • Eulerian graph: each edge appears once and only once in a path
  • Hamiltonian graph: each vertex appears once and only once in a path. Hamiltonian cycle of minimal weight --- Travel Salesman Problem (TSP)

An Euler path:

An Euler loop:

Euler grahp: loop

Semi-Euler praph: path, no loop

Problem of Eulerian loop: simple, known solutions

Problem of Hamiltonian paths: much harder

hamiltonian loops much harder

Hamiltonian Loops: much harder


10 nodes

15 arcs

di=3 nodes

Traveling Salesman Problem

NP-hard problems


graph nodes arcs directed labeled arcs and nodes simple graph no rings at nodes no repeated arcs
Graph = nodes + arcs

Directed , Labeled arcs and nodes

Simple graph:

No rings at nodes:

No repeated arcs:




indegree d in i outdegree d out i euler graph d in i d out i di i
Indegree din(i)

Outdegree dout(i)

Euler graph:

din(i) = dout(i)  dii


Simple Euler GraphDiagonal matrix:M=diag( d1, d2, … dn )Adjacent matrix:A={aij} aij= aii= 0Kirchhoff matrix:C=M-ACij=  Cij=0 det(C)=0All minors of C are equal. Denote this common minor by








Number of Euler loops in simple Euler Graph

N G de Bruijn

T van Aardenrie Ehrenfest

C A B Smith

W T Tuite

BEST Theorem

e (G) = (di-1)!




Number of Eulerian loops in general Eular G.

some aii0rings

some aij>1parallel arcs

Putting auxiliary nodes on these rings and parallel arcs makes the graph simple.


No need to work with bigger A matrix.

Just let some aii0, aij>1 in original A.

Eliminate redundancy caused by unlebeled arcs.

Modified BEST Theorem:

e(G) =



 aij!


anpa pseam 82aa malslftvgqliflfwtmriteaspdpaakaapaaaaapaaaapdtasdaaaaaaltaanakaaaeltaanaaaaaaatarg













anpa pseam 82aa antifreeze protein a b precursor in winter flaunder alanine rich amphiphilic

6 rings


Antifreeze protein

A/B precursor in winter flaunder



auxiliary arc


From pdb.seq-a special selection of SWISSPROT2821-1=2820 proteins ( May 2000 )R—number of reconstructed AA sequences from a given protein decomposition

compositional representation of proteins

Compositional Representation of Proteins


L= -k+1







The collection {W }or {W ,n j}may be used as an equivalent representation of the original protein sequence.

A seemingly trivial result upon further reflection: random AA sequences have unique reconstruction as well.

Compositional Representation works equally for random AA sequences and most of protein sequences.

A given realization of a short random AA sequence is as specific as a real protein sequence.


Nucleotide correlations in DNA/RNA

Much studied

K=2 correlation functions 16 9 6

See Wentian Li, Computer Chem. 21(1997) 257-271.

Amino Acid correlations in Proteins

Almost no study

Hard to comprehend 400 correlation functions at K=2

Proteins too short to define correlation functions

One should approach the problem from a more deterministic point of view

Repeated AA segments in proteins are strong manifestation of correlations!


On-going study: the other extreme

Quit a few proteins have an enormous

number of reconstructions.



Fibrous: collagens

Coarse-graining: closer to biology by reducing the number of AAs



NSF – ITP – 01 – 018

LANL E-archive physics/0103028 or

Cross-referenced in q-bio since 15 Sept 2003