I lezione parte b
Download
1 / 12

I LEZIONE PARTE B - PowerPoint PPT Presentation


  • 111 Views
  • Uploaded on

I LEZIONE PARTE B. Lavorare con le sequenze nucleotidiche: Formato FASTA Traduzione Mascheramento Inverso complementare (Utilizzo di BCM sequence utilities). ANALISI DI SEQUENZE IL FORMATO FASTA una sola linea di descrizione che inizia con “>”

loader
I am the owner, or an agent authorized to act on behalf of the owner, of the copyrighted work described.
capcha
Download Presentation

PowerPoint Slideshow about 'I LEZIONE PARTE B' - janae


An Image/Link below is provided (as is) to download presentation

Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author.While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server.


- - - - - - - - - - - - - - - - - - - - - - - - - - E N D - - - - - - - - - - - - - - - - - - - - - - - - - -
Presentation Transcript
I lezione parte b
I LEZIONEPARTE B

Lavorare con le sequenze nucleotidiche:

  • Formato FASTA

  • Traduzione

  • Mascheramento

  • Inverso complementare

    (Utilizzo di BCM sequence utilities)


ANALISI DI SEQUENZE

IL FORMATO FASTA

una sola linea di descrizione che inizia con “>”

poi la sequenza, senza spazi, linee vuote, e caratteri “strani”.

solo caratteri che seguano il codice IUB/IUPAC per gli aminoacidi e gli acidi nucleici

il “–” indica un gap

>gi|129295|sp|P01013|OVAX_CHICK GENE X PROTEIN (OVALBUMIN-RELATED) QIKDLLVSSSTDLDTTLVLVNAIYFKGMWKTAFNAEDTREMPFHVTKQESKPVQMMCMNNSFNVATLPAEKMKILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKIEEKYNLTSVLMALGMTDLFIPSANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTGVIEDIKHSPESEQFRADHPFLFLIKHNPTNTIVYFGRYWSP


IL FORMATO FASTA

Codice per gli acidi nucleici:

A --> adenosine M --> A C (amino)

C --> cytidine S --> G C (strong)

G --> guanine W --> A T (weak)

T --> thymidine B --> G T C (not A)

U --> uridine D --> G A T (not C)

R --> G A (purine) H --> A C T (not G)

Y --> T C (pyrimidine) V --> G C A (not T)

K --> G T (keto) N --> A G C T (any)

- gap of indeterminate length


IL FORMATO FASTA

Codice per gli aminoacidi:

A alanine P proline

B aspartate or asparagine Q glutamine

M methionine N asparagine

C cystine R arginine

D aspartate S serine

E glutamate T threonine

F phenylalanine U selenocysteine

G glycine V valine

H histidine W tryptophan

I isoleucine Y tyrosine

K lysine Z glutamate or glutamine

L leucine X any

* translation stop


  • ANALISI DI SEQUENZE

  • Uso di BCM ReadSeq per la conversione in formato FASTA

  • Uso di BCM Reverse Complement, per fare l’inverso complementare di una sequenza


TRADUZIONE

  • Il codice genetico: senza sovrapposizione  triplette  codoni

  • 20 amminoacidi e 4 nucleotidi  4, 42, 43=64  piu’ parole del necessario  degenerazione (tutti i codoni hanno un significato  alcuni aa sono specificati da piu’ codoni).

  • Da 1 a 6 codoni per aa.

  • Vacillamento nella terza posizione.

  • Codoni di STOP: UAG, UGA e UAA


TRADUZIONE

The STANDARD Genetic Code

SerinaCodone tRNA anticodone

UCU o UCC tRNAser1 AGG + vacillamento

UCA o UCG tRNAser2 AGU + vacillamento

AGU o AGC tRNAser3 UCG + vacillamento

6 Frame Translation - translates a nucleic acid sequence in 6 frames (BCM)

6


TRADUZIONE

  • Diversi codici genetici

  • Codice genetico mitocondriale di animali

  • AUA  Met invece di Ile

  • UGA  Trp invece di STOP

  • AGA e AGG  STOP invece di Arg (UAA, UAG, AGA, AGG)

  • Altri codici in micoplasmi, protozoi e funghi.

  • Uso di BCM 6 frames translation per la traduzione di sequenze nucleotidiche


MASCHERAMENTO

Piu’ del 25% del genoma degli eucarioti e’ formato da DNA altamente ripetitivo

DNA ripetitivo:

  • DNA ripetuto in tandem

  • DNA ripetuto intersperso


MASCHERAMENTO

Major classes of tandemly repeated human DNA:

Class Size of repeat Major chromosomal location(s)

‘Megasatellite' DNA several kb Various locations on selected

(blocks of hundreds of chromosomes

kb in some cases)

Satellite DNA 5–171 bp Especially at centromeres

(blocks often from 100 kb

to several Mb in length)

Minisatellite DNA 6–64 bp At or close to telomeres of all

(blocks often within chromosomes

the 0.1–20 kb range)

Microsatellite DNA 1–4 bp Dispersed throughout all

(blocks often less than 150 bp) chromosomes


MASCHERAMENTO

Il DNA ripetuto intersperso si origina per ricombinazione o, soprattutto per trasposizione. La maggior parte dei trasposono sono retrotrasposoni, che, nei mammiferi, includono:

LINEs (long interspersed nuclear elements)

Elementi LINE-1 nell’uomo ed in altri mammiferi.

SINEs (short interspersed nuclear elements)

Alu repeat, una ogni circa 3 Kb nel genoma umano, anche Alu trascritte.

La sequenza delle ripetizioni e’ specie-specifica o lineage-specifica

Primati: alpha satellite 340 basi


MASCHERAMENTO

Uso di RepeatMasker per il mascheramento di sequenze genomiche


ad