slide1 n.
Download
Skip this Video
Loading SlideShow in 5 Seconds..
BSc. Jun Sotelo Romero Unidad de Bioinformática y Biología Computacional LID-UPCH PowerPoint Presentation
Download Presentation
BSc. Jun Sotelo Romero Unidad de Bioinformática y Biología Computacional LID-UPCH

Loading in 2 Seconds...

play fullscreen
1 / 96

BSc. Jun Sotelo Romero Unidad de Bioinformática y Biología Computacional LID-UPCH - PowerPoint PPT Presentation


  • 109 Views
  • Uploaded on

La Pirazinamidasa (PZAsa) de Mycobacterium Tuberculosis : Aspectos Moleculares del Mecanismo de Resistencia. BSc. Jun Sotelo Romero Unidad de Bioinformática y Biología Computacional LID-UPCH Laboratorio de Enfermedades Infecciosas LID-UPCH. Mycobacterium tuberculosis.

loader
I am the owner, or an agent authorized to act on behalf of the owner, of the copyrighted work described.
capcha
Download Presentation

BSc. Jun Sotelo Romero Unidad de Bioinformática y Biología Computacional LID-UPCH


An Image/Link below is provided (as is) to download presentation

Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author.While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server.


- - - - - - - - - - - - - - - - - - - - - - - - - - E N D - - - - - - - - - - - - - - - - - - - - - - - - - -
    Presentation Transcript
    1. La Pirazinamidasa (PZAsa) de Mycobacterium Tuberculosis : Aspectos Moleculares del Mecanismo de Resistencia BSc. Jun Sotelo Romero Unidad de Bioinformática y Biología Computacional LID-UPCH Laboratorio de Enfermedades Infecciosas LID-UPCH

    2. Mycobacterium tuberculosis • Agente etiológico de la Tuberculosis, la enfermedad infecciosaquemás muertesprovoca en el mundo. • La Tuberculosis es un complejo de fenómenos microbiológicos e inmunológicos que escapa a una definición simple. • Nuevos Problemas: • Asociación con la infección del virus delVIH. • Resistenciaa la acción de los fármacos. • El Mycobacterium tuberculosises capaz de causar tanto un proceso agudo de enfermedad como una infecciónlatenteasintomática. Un tercio de la población mundial puede estar infectada con el bacilo en este estado.

    3. Tuberculosis mata a 2 persona en el mundo cada 15 segundos

    4. Problemática de la Tuberculosis • Reemergencia. • Asociación a HIV. • 2/3 personas infectadas con TB. GLOBAL Países Industrializados • Problema endémico • Asociado a “pobreza”, desnutrición, drogadicción y otras enfermedades. • Concentrado en “bolsones”. • 90% TB del Perú → Lima. NACIONAL Países en Desarrollo

    5. Transmisión de la TB • Vía aérea ( partículas suspendidas en el aire ). • Existe alta transmisión de TB en el grupo de 15-20 años. • Existen factores que predisponen la manifestación clínica de la enfermedad.

    6. Infección en los alvéolos Los bacilos se multiplican y se movilizan hacia los ganglios linfáticos traqueobronquiales Hipersensibilidad de tipo retardadoe inmunidad mediada por células Positividad con la tuberculina Poca o ninguna hipersensibilidad. Negátividad con la tuberculina Se contiene la enfermedad Las bacterias viven pero no se multiplican Enfermedad sístemica progresiva y Muerte De estos 6% TBC Clínica - 2% Pulmonar - 3% extratorácica - 1% ambos casos 3% Enfermedad sistémica progresiva y Muerte. 91% sinenfermedad LATENCIA

    7. Vacunas para TB • No existevacuna efectiva contra TB. • BCG (La vacuna de bacilo de Calmette-Guérin). ● No protege para la TB pulmonar. ●Si protege para TB meningea -Muy rara. - Necesario si se trata de una zona endémica.

    8. Diagnóstico de TB • No existen pruebas serológicas (ELISA, Western Blot ). • En general, no existen pruebas tradicionales rápidas. • Método convencional → “cultivo” 2-3 meses ( para conocer la susceptibilidad a las drogas ). • MAYOR PROBLEMA : Dar el tratamiento específico para cada paciente.

    9. Tratamiento de TB • Drogas de 1° Línea. • Un gran problema es el incremento de la TB MDR. • Una DROGA MUY IMPORTANTE→Pirazinamida - Única droga que mata al Myc. Tub. en estado latente. - Tratamiento estándar + PZA → Mejores resultados. Rifampicina Isoniazida Las más efectivas y con menos efectos laterales pero ↑ RESISTENCIA TB MDR es resistente al menos a Rifampicina e Isoniazida.

    10. El problema de la Tuberculosis multidrogo resistente en el Perú • Estimados de niveles de resistencia a drogas en pacientes que ingresan al esquema de tratamiento Estandarizado (1997-2003) Etionamida (E) 40%Etambutol (Et) 45%Pirazinamida (Z) 30%Ciprofloxacina (C) 4%Kanamicina (K) 3% Datos de la Unidad Técnica TBMDR- MINSA

    11. Estructura de la Pirazinamida (PZA) y sus análogos

    12. Hidrólisis de la PZA por parte de la enzima Pirazinamidasa PZAase

    13. Mecanismo antibacteriano de la PZA CAUSAS DE RESISTENCIA : Falla funcional de la PZAase. Falla del sistema de flujo/eflujo. Falla del ingreso de la PZA.Mutaciones en el promotor???

    14. J Bacteriol. 2000 Jul;182(13):3881-4.Related Articles, Links • Mycobacterium smegmatis has two pyrazinamidase enzymes, PncA and pzaA.Guo M, Sun Z, Zhang Y.Department of Molecular Microbiology and Immunology, School of Hygiene and Public Health, Johns Hopkins University, Baltimore, Maryland 21205, USA.The Mycobacterium smegmatis pncA gene, encoding nicotinamidase/pyrazinamidase, was identified. While it was similar to counterparts from other mycobacteria, the M. smegmatis PncA had little homology to the other M. smegmatis pyrazinamidase/nicotinamidase, encoded by the pzaA gene. Transformation of Mycobacterium bovis strain BCG with M. smegmatis pncA or pzaA conferred susceptibility to pyrazinamide.PMID: 10851013 [PubMed - indexed for MEDLINE]

    15. Identification, cloning, and expression of the Escherichia coli pyrazinamidase and nicotinamidase gene, pncA.Frothingham R, Meeker-O'Connell WA, Talbot EA, George JW, Kreuzer KN.Infectious Diseases Section, Durham Veterans Affairs Medical Center, North Carolina 27705, USA. rfr@galactose.mc.duke.eduPyrazinamide (PZA) is one of the three most important drugs for treatment of Mycobacterium tuberculosis infections. The antibacterial activity of PZA requires a bacterial enzyme, pyrazinamidase (PZAase), which hydrolyzes PZA to form pyrazinoic acid and ammonia. Most PZA-resistant clinical M. tuberculosis isolates lack PZAase activity. With the goal of eventually identifying and characterizing the M.tuberculosis PZAase gene, we began with the more tractable organism, Escherichia coli, which also has PZAase activity. We screened a transposon-generated E. coli insertion mutant library, using a qualitative PZAase assay. Two PZAase-negative mutants out of 4,000 colonies screened were identified. In each mutant, the transposon interrupted the same 639-bp open reading frame (ORF), ORF1. The expression of ORF1 on a multicopy plasmid complemented a PZAase-negative mutant, leading to PZAase activity levels approximately 10-fold greater than those of the wild type. PZA has a structure similar to that of nicotinamide, a pyridine nucleotide cycle intermediate, so we tested our strains for nicotinamidase activity (EC 3.5.1.19) (genetic locus pncA). The construct with multiple plasmid copies of ORF1 had an approximately 10-fold increase in levels of nicotinamidase activity. This overexpressing strain could utilize nicotinamide as a sole nitrogen source, through wild-type E. coli cannot. We conclude that a single E. coli enzyme accounts for both PZAase and nicotinamidase activities and that ORF1 is the E.coli PZAase and nicotinamidase gene, pncA.

    16. Publicación del genóma de Mycobacterium tuberculosis : Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence. S. T. Cole, y Col Nature 393, 537-544 (1998).

    17. Secuencias de ADN y aminoácidos de la PZAaseTB cepa H37rvgi|1706963|gb|U59967.1|MTU59967 1 atgcgggcgt tgatcatcgt cgacgtgcag aacgacttct gcgagggtgg ctcgctggcg 61 gtaaccggtg gcgccgcgct ggcccgcgcc atcagcgact acctggccga agcggcggac 121 taccatcacg tcgtggcaac caaggacttc cacatcgacc cgggtgacca cttctccggc 181 acaccggact attcctcgtc gtggccaccg cattgcgtca gcggtactcc cggcgcggac 241 ttccatccca gtctggacac gtcggcaatc gaggcggtgt tctacaaggg tgcctacacc 301 ggagcgtaca gcggcttcga aggagtcgac gagaacggca cgccactgct gaattggctg 361 cggcaacgcg gcgtcgatga ggtcgatgtg gtcggtattg ccaccgatca ttgtgtgcgc 421 cagacggccg aggacgcggt acgcaatggc ttggccacca gggtgctggt ggacctgaca 481 gcgggtgtgt cggccgatac caccgtcgcc gcgctggagg agatgcgcac cgccagcgtc 541 gagttggttt gcagctcctg a MRALIIVDVQNDFCEGGSLAVTGGAALARAISDYLAEAADYHHV VATKDFHIDPGDHFSGTPDYSSSWPPHCVSGTPGADFHPSLDTS AIEAVFYKGAYTGAYSGFEGVDENGTPLLNWLRQRGVDEVDVVG IATDHCVRQTAEDAVRNGLATRVLVDLTAGVSADTTVAALEEMR TASVELVCSS

    18. El alineamiento múltiple de aprox. 120 genes de PZAase secuenciados a partir de cepas “peruanas” sensibles y resistentes muestran una alta conservación de la región promotora TATA Box Start codon Región promotora

    19. Distribución de mutaciones ‘únicas’ halladas en el gen de PZAsa

    20. Clonación y Purificación de PZAase H37RV y mutantes • Expresar el gen recombinante en E. coli. • La clonación adiciona 6 His al extremo COO- de la enzima. • La purificación se realiza mediante Cromatografia de Afinidad por Columna de Níquel. • Las His terminales se enlazan al Niquel. Luego se realiza un lavado con solución de imidazol.

    21. Purificación de la enzima PZAsa

    22. Parámetros cinéticos y la actividad enzimática de PZAsas mutantes Búsqueda de una explicación a nivel : Estructura-Función !!!

    23. Análisis Estructural y Creación del Modelo • No existen cristales de PZAase de Mycobacterium tuberculosis. • Se modelaron las estructuras utilizando el expassy server. • Buena homologia (37%). - PZAase de Mycobacterium tuberculosis - PZAase de Pyrococcus horikoshi (pdb 1IM5 ) • Disposicion espacial del backbone aceptable (prochek).

    24. PZAase de Pirococcus horikoshii pdb 1IM5

    25. Debido a la analogía entre la PZAase de Pyrococcus horikoshii (PH999) y la de Mycobacterium tuberculosis; PH999 brinda las bases estructurales para entender la resistencia a la PZA en Mycobacterium tuberculosis ocasionada por mutaciones de PZAase.

    26. Sitio Activo de la PZAase de Pirococcus horikoshii Metaloenzima de Zinc N.C. 6 (2His, 1Asp,3H2O)

    27. Anillo catalítico de la PZAsa de pyrococcus hirokoshii (Ala129, Cys133, Lys94, Asp10)

    28. Mecanismo de Acción propuesto en PZAase de Pirococcus horikoshii Sitioactivo “Anclaje” de la PZA

    29. C133→D10 Transferencia protónica 1). Rxn C133→PZA 1° ataque nucleofílico

    30. C de PZA sp2→sp3. O de PZA sp2→sp3 PZA unido covalentemente a PZAase.

    31. D10 : protona a NH2 de PZA.2). RxnSe libera NH3. O de PZA sp3→sp2

    32. 3). RxnZNOH→PZA 2° ataque nucleofílico C de PZA sp2→sp3. O de PZA sp2→sp3

    33. N.C. Zn de 6→5

    34. 4). RxnH2O del medio N.C. Zn de 5→6 Protonación de D10

    35. 5). RxnC-S de PZA desprotona D10 O de PZA sp2→sp3

    36. Se libera ácido pirazinoico. Se regenera la enzima

    37. En resumen :

    38. Dinámica Molecular por “Manual Bonding” - César Lopez & Mirko Zimic • Las reacciones químicas no ocurren a 2D. Ocurren en 3D. • Se debe estudiar el mecanismo de reacción tridimensionalmente. “ En tiempo real ”. • La Dinámica molecular nos permite estudiar un proceso físico-químico en tiempo real siempre y cuando no se formen o rompan enlaces químicos (tratamiento cuánticos muy costosos).

    39. Dinámica Molecular por “Manual Bonding” - GROMACS • Propuesta : Realizar Dinámica Molecular a cada etapa de la reacción química. • Cuando estemos ante una “inminente” formación o ruptura de enlace químico detenemos la dinámica. • Distancias interatómicas • Ángulos interatómicos. • Energías de activación • Formamos el nuevo enlace “manualmente” y continuamos con la dinámica molecular.

    40. Dinámica Molecular por “Manual Bonding” - GROMACS • LaPZA se “dockeo” a la PZAase empleando el software AUTODOCK.

    41. Localizacion de la Pyrazinamida en el sitio activo

    42. Dinámica Molecular por “Manual Bonding”. Hidrólisis de PZA en PZAase PH999

    43. Sitioactivo