20 likes | 22 Views
Anti-ACMSD polyclonal antibody can be provided from Creative Diagnostics.<br>https://www.creative-diagnostics.com/Anti-ACMSD-PAb-188719-147.htm<br>
E N D
Anti-ACMSD (aa 179-278) polyclonal antibody Anti-ACMSD (aa 179-278) polyclonal antibody (DPAB-DC539) (DPAB-DC539) This product is for research use only and is not intended for diagnostic use. PRODUCT INFORMATION PRODUCT INFORMATION Antigen Description Antigen Description The neuronal excitotoxin quinolinate is an intermediate in the de novo synthesis pathway of NAD from tryptophan, and has been implicated in the pathogenesis of several neurodegenerative disorders. Quinolinate is derived from alpha-amino-beta-carboxy-muconate-epsilon- semialdehyde (ACMS). ACMSD (ACMS decarboxylase; EC 4.1.1.45) can divert ACMS to a benign catabolite and thus prevent the accumulation of quinolinate from ACMS.[supplied by OMIM, Oct 2004] Immunogen Immunogen ACMSD (NP_612199, 179 a.a. ~ 278 a.a) partial recombinant protein with GST tag. The sequence is SHGFSMRPDLCAQDNPMNPKKYLGSFYTDALVHDPLSLKLLTDVIGKDKVILGTDYPFPLGELEP GKLIESMEEFDEETKNKLKAGNALAFLGLERKQFE Source/Host Source/Host Mouse Species Reactivity Species Reactivity Human Conjugate Conjugate Unconjugated Applications Applications WB (Cell lysate), WB (Recombinant protein), ELISA, Size Size 50 μl Buffer Buffer 50 % glycerol Preservative Preservative None Storage Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. GENE INFORMATION GENE INFORMATION Gene Name Gene Name ACMSD aminocarboxymuconate semialdehyde decarboxylase [ Homo sapiens (human) ] Official Symbol Official Symbol ACMSD Synonyms Synonyms ACMSD; aminocarboxymuconate semialdehyde decarboxylase; 2-amino-3-carboxymuconate-6- 45-1 Ramsey Road, Shirley, NY 11967, USA Email: info@creative-diagnostics.com Tel: 1-631-624-4882 Fax: 1-631-938-8221 1 © Creative Diagnostics All Rights Reserved
semialdehyde decarboxylase; picolinate carboxylase; Entrez Gene ID Entrez Gene ID 130013 Protein Refseq Protein Refseq NP_612199 UniProt ID UniProt ID Q8TDX5 Chromosome Location Chromosome Location 2q21.3 Pathway Pathway 2-amino-3-carboxymuconate semialdehyde degradation to glutaryl-CoA; Metabolism; Tryptophan catabolism; Tryptophan metabolism. Function Function aminocarboxymuconate-semialdehyde decarboxylase activity; metal ion binding; 45-1 Ramsey Road, Shirley, NY 11967, USA Email: info@creative-diagnostics.com Tel: 1-631-624-4882 Fax: 1-631-938-8221 2 © Creative Diagnostics All Rights Reserved