Download
slide1 n.
Skip this Video
Loading SlideShow in 5 Seconds..
Perawatan-Dietetik-bagi-Penderita-Obesitas PowerPoint Presentation
Download Presentation
Perawatan-Dietetik-bagi-Penderita-Obesitas

Perawatan-Dietetik-bagi-Penderita-Obesitas

143 Views Download Presentation
Download Presentation

Perawatan-Dietetik-bagi-Penderita-Obesitas

- - - - - - - - - - - - - - - - - - - - - - - - - - - E N D - - - - - - - - - - - - - - - - - - - - - - - - - - -
Presentation Transcript

  1. Obesitasataukegemukanadalahistilah yang digunakanuntukmenunjukkanadanyapenumpukkanlemaktubuh yang melebihibatas normal. Penumpukkanlemaktubuh yang berlebihanituseringdapatterlihatdenganmudah. Akantetapiperludisepakatisuatubatasanuntukmenentukanapakahseseorangdikatakanmenderitaobesitasatautidak. Tingkat obesitasditentukanolehjumlahkelebihanlemakdalamtubuh. Secarapraktisdigunakanukuranberupaperbandinganberatbadanterhadapberatbadanbakuuntukukurantinggitubuhtertentu. Kelebihanberatbadandibandingkandenganberatbadanbakuitudinyatakandalampersentase, 10%, 20%, ataupun 30%. 1. MenentukanObesitaspadaOrangDewasaPenentuankeadaangizipadaorangdewasaumumnyamenggunakanrumus “beratbadan ideal” yaitu: BeratBadan Ideal = [TinggiBadan (cm) - 100] - 10% Jikaberatbadanseorangwanitalebihbesar 10 - 20% dariberatbadanidealnya, makawanitaitudisebutgemuk. Jikaberatbadannyalebihdari 20% beratbadanidealnya, makaiadisebutobesitas. Tinggidanberatbadanwanitaberbedadengantinggidanberatbadanpria. Sebab, adaperbedaanproporsitubuhantarawanitadanpria. Perbedaanproporsiitudapatdilihatdaribentuktubuh, strukturjaringantubuh, besarnyatubuh, danfungsi fall tubuh. Jikaobesitasdidefinisikansebagaiterjadinyapenumpukanlemakdalamtubuh, makapenggunaanberatbadansajasebagaiindikatoruntukmenentukanobesitastidaklahtepat. Hal itudisebabkanolehberatbadantidakhanyamenggambarkankelebihanlemakdalamtubuh, tetapijugajaringantubuh yang lain. Atlet-atletangkatbesi, binaraga, atauatletyudomempunyaistrukturotot yang lebihbesarsehinggaberatbadanmerekajugaakanlebihbesar. Lebihdarisetengahlemakbadantersimpandibawahkulitdalambentukjaringanadiposa. Jaringanadiposaterdiriatas 80 - 85% lemak, 2% protein, dan 10% air. Jumlahlemakbadan yang ideal bagipriakuranglebih 12% dariberatbadan total, sedangkanuntukwanitalebihkurang 26%. Jikajumlahlemakpadapriamelebihi 20% beratbadannyadanwanitamelebihi 30% beratbadannya, makamerekasudahtergolongterlalugemuk (obesitas). 2. Dasar-dasarPerawatandanPengaturan Diet PenderitaObesitasApa pun penyebabobesitas yang terpentingadalahbagaimanamerawatpenderitaobesitas agar beratbadannyakembali normal atau paling tidakmenghindarkannyasemaksimalmungkindariakibatlangsungataukomplikasi yang timbulkarenaobesitasitu. Beberapahalpenting yang perludiperhatikandalamperawatanobesitasantara lain adalah: Pertama,haruslahditumbuhkankeyakinanpadadiripenderita, alasan-alasanapa yang mengharuskannyamelakukanupayamenurunkanberatbadannya. Dalampraktik, banyakpenderita yang tidakberhasildalamupayamenurunkanberatbadannya, karenapenderitakurangyakinakanmanfaat yang diperolehnyaapabilaberatbadannyakembali normal, danakibat yang akanterjadikarenaobesitasitu. Kedua,penderitaobesitasperludiberikanpengetahuandasarmengenaizatgizidanfungsinya, prosespembentukandanpenggunaanenergidalamtubuh, pembentukancadanganlemakdanpengaruhkegiatanfisikterhadappenggunaanenergidancadanganlemak.Jugaperludiberikanpetunjuktentangcaramemperkirakanjumlahenergi yang didapatnyadarimakanandanperkiraanpemakaianenergiolehtubuhnyasetiaphari. Dengandemikian, penderitadituntununtukmengusahakanterjadinyakeseimbanganantarapemasukanenergi yang berasaldarimakanan yang dimakannyadanpenggunaanenergiolehtubuhsehinggaiamampumengendalikankonsumsimakanan. Ketiga,penderitaobesitasharusdibebaskandariberbagaiinformasi yang salahataumenyesatkan yang mungkindidapatnyadaritulisan-tulisan yang bernadapromosiatau yang dibuatolehpenulis yang bukanahli yang dapatmembawaakibatburukbagidirinya.Cerita-ceritatentangmakanan yang dapatmembuatkurusatau slimming food hendaklahdijauhkandarinya, dankepadanyaharusdiyakinkanbahwatidakadamakanan yang dapatmembuatseseorangmenjadikurustanpapembatasankalori. Karenadasarpenurunanberatbadanadalahmengurangijumlahenergi yang masuk yang berasaldarimakanandanmenaikkanpengeluaranenergimelaluipenambahankegiatanfisik. Keempat,mendorongterjadinyaperubahanperilaku. Tidakdapatdisangkabahwauntukmematuhisuatu diet secarasungguh-sungguhuntukpenurunanberatbadantidaklahmudahdanakanmerupakanperjuanganberat.Godaanbukansemata-mataberupatimbulnya rasa lapar, akantetapijugakebiasaan yang sudahmendarahdaging yang justrulebihsukardiatasi. Kepuasanpsikologis yang diperolehsewaktumengunyahmakananseringlebihtidaktertahanolehpenderitaobesitas, sehinggamerekamelanggar diet yang harusmerekajalani.Olehkarenaitudisampingpendekatandarisudutmedisdandietetikan, dalamupayapenanggulanganobesitasjugadilakukanpendekatanpsikologisuntukmendorongperubahanperilaku. Kelima,mengenaikepatuhanpenderitaterhadap diet yang harusdijalani. Penderita yang mempunyaikebiasaanmakandiluarrumah, ataukarenatugasdanpekerjaanharusseringmenghadiriresepsiataujamuanmakan, biasanyakurangberhasildalamupayamenurunkanberatbadan. Keenam,tentangpenyusunan diet yang diberikanharusdidasarkanataskebiasaandanperilakupenderitasehari-haridalamhalmakanan. Mereka yang biasasarapanpagidenganrotisebagaimakananpokok, harusdiberi diet rotiuntukmakanpagi. Apabilapenderitaselalumerasatidakpuasitujustrumerupakanpendorongbaginyauntuktidakmematuhidietnya. Karenaitu diet yang akandiberikansebaiknyadidiskusikanlebihdahuludenganpenderitauntukdisesuaikandengankebiasaan, selera, dankemauanpenderita. Dengandemikiandiharapkanpenderitaakanlebihpatuh. 3. Pengaturan Diet bagiPenderitaObesitasDiet yang diberikanharusdapatmenjadikecukupanzatgizidankesehatanpenderita. Iniberarti vitamin dan mineral harusterdapatdalamjumlah yang sesuaidengankebutuhan.Tujuanutama program diet bagipenderitaobesitasadalahmenurunkanberatbadan. Karenaitusebelummemulai program diet, perluditentukan program diet yang akandilakukansecaraterperinci. Berdasarkantinggisertaposturtubuhpenderita, ditentukanlebihdahuluberatbadan normal penderita. Setelahitudihitungkelebihanberatbadan yang harusditurunkan. Denganmengetahuiberatbadan normal dandenganmenggunakaninformasikegiatanfisikpenderitasehari-hari, kebutuhanenergi rata-rata per haridapatditentukan. Akantetapidapatjugadigunakanpedomankebutuhanenergiberdasarkankecukupanzatgizisebagaiberikut: Wanitaberusia 35 tahun yang melakukanpekerjaringanmemerlukankaloriantara 1800 kalsampai 2000 kal per hari. Jikakepadanyadiberikan diet dengankandungankalori 1200 kalsehari, makaberartisetiaphariakanterjadikekurangan 600 kal. Untukmencukupikebutuhannya, setiaphariakandimobilisasilemaksebanyak (600 : 7,5) gram yaitu 80 garam (tiap gram lemakbadandalamprosesoksidasiakanmenghasilkan 7,5 kal). Iniberartidengan diet 1200 kal per hari, beratbadanakanturunsebanyak 80 gram setiaphariatausebanyak 2,4 kg per bulan. Penurunanberatbadan 2,4 kg sampai 4,0 kg setiapbulanmerupakan target yang normal dantidakmembawaakibatsampinganapa pun. Di sampingpedomanumum yang telahdikemukakanitu, adaketentuan-ketentuankhusus yang harusdiikutidalampenetapan diet penderitaobesitas, antara lain adalahtentangkandunganserat, hidratarang, protein, danlemakdalam diet untukpenderitaobesitas. KandunganSerat Kandunganseratdalam diet obesitasharussetinggimungkin. Gunanyaadalahuntukmenghambatpenyerapanhidratarang, protein, danlemak. Disampingitukandunganserat yang tinggidalam diet akanmenyebabkantimbulnya rasa kenyanglebihcepat. Hal inipentingsekali agar penderitadapatmematuhidietnya. Terhalangnyapenyerapanzatlemakolehseratdapatmengurangikemungkinanpenyerapankolesterol.Diet dengankadarserattinggisangatdianjurkanolehdokter Reuben, yang mengutamakanbahanmakananberupasayurandanbuah-buahan. Dagingdanikandipilih yang kadarlemaknyarendahsedangkanguladigantidenganmaduatautetes. Diet dokter Reuben didasarkanatasdugaanbahwajikaseoranginginmenurunkanberatbadannya, makaiaharusmakandalamjumlahsedikitmungkin, tetapimemberikan rasa kenyang yang cukup. Keinginanituakanterpenuhijikakandunganseratdalamdietnyacukuptinggi. KandunganKarbohidrat Hidratarangadalahsalahsatusumberenergi yang diperolehdarijenisbahanmakanansepertinasi, roti, kentang, dansebagainya. Karenaitupembatasankandunganhidratarangdalam diet berartipembatasanpenggunaanbahanmakanansepertinasi, roti, kentang, jagung, atausumberhidratarang yang lain. Akantetapipembatasankandunganhidratarangdalam diet ituadabatasnya.Jikakadarhidratarangterlalurendah, tubuhakanmemobilisasilemaktubuhsebagaisumberenergi. Penggunaanlemaktubuhsecaraberlebihansebagaisumberenergiakanmengakibatkantertumpuknyazatantarahasilpembakaranlemaktubuh yang disebutzatketon. Penumpukanzatketondalamtubuhdalamjumlah yang berlebihanakanmenyebabkanterjadinyakeracunanzatketon yang disebut ketosis. Tanda-tandaterjadinya ketosis adalahtimbulnya rasa mual, tubuhmengalamidehidrasi, danlemah. Padatingkatselanjutnyaakanterjadikegagalanfungsiginjal.Untukmenghindariterjadinya ketosis, makakandunganhidratarangdalam diet dianjurkansekitar 40% kandungankalori total dalam diet. Jikapenderitaobesitasmemperoleh diet dengankandungankalori 1200 kalsehari, makajumlahhidratarangsebaiknyaadalah 40% x 1200 kal = 480 kal, atausetaradengan 120 gram hidratarang, yang jikadinyatakandalambentukberasadalah 150 gram beras. Kandungan Protein Fungsiutama protein adalahmemeliharakeseimbangan nitrogen dalamtubuh. Akantetapidalamkeadaankekuranganenergi, protein jugadapatberfungsisebagaisumberenergi. Protein yang berasaldarimakananmelaluipencernaanakandiserapolehdindingusussebagaiasam amino danmasukkedalamdarah.Melaluiprosesreaksianabolik, sebagianasam amino digunakanuntuksintesis protein tubuh. Sebagianlagi, melaluiprosesreaksikatabolik, dandigunakanuntukmemberienergi. Protein merupakansumberenergi yang mahalkarena diet dengankandungan protein tinggiharusmenggunakanbanyakbahanmakanansepertidaging, susu, telur, ikan, dansebagainya yang harganyamahaldibandingkandenganhargabahanmakanansumberhidratarangdanlemak. KandunganZatLemak Zatlemakmendudukitempatkeduasebagaisumberenergisetelahhidratarang. Olehkarenatiap gram zatlemakmenghasilkankaloridua kali lebihbanyakdari yang dihasilkanolehhidratarang, maka diet dengankadarlemak yang tinggidengansendirinyajugaberartikandungankalorinyatinggi.Karenaitu, tidakmengherankanbahwamakanandengankandunganlemak yang tinggiseringdianggapsebagaipenyebabutamaterjadinyakelebihankalori. Kelebihankaloriituakanditumpuksebagailemaktubuh, dankeadaandemikianitumerupakanpangkalterjadinyaobesitas.Dengandemikian, persyaratanpokokdalammenyusun diet dengankandungan diet tersebut, sampaibatas yang tidakmenimbulkanakibatsampingan yang lain.Kandunganzatlemak yang dianjurkanuntuk diet penderitaobesitasbergantungpadakandungankalori total dalam diet yang akandiberikan. Diet dengankandungankalori 1800 kalsetiapharidianjurkanterdiriatas: 225 gram hidratarang, 90 gram protein, dan 60 gram zatlemak. Jikakandungankalorisebanyak 1200 kalsehari, makakomposisi yang dianggapcukupadalahterdiriatas: 150 gram hidratarang, 60 gram protein, dan 40 gram zatlemak. Untuk diet dengankandungankalori 1000 kalkomposisi yang dianjurkanadalah 100 gram hidratarang, 60 gram protein, dan 40 gram zatlemak. Perawatandietetikbagipenderitaobesitasadalahperawatanuntukjangkawaktu lama. Banyakpenderitasetelahberhasilmenurunkanberatbadannyabeberapa kilogram, kemudianmenganggaptidakperlulagimenjalani diet. Akibatnyaberatbadannyaakannaikkembalidanhalitupentingmenimbulkan rasa kecewa. Untukmenurunkanberatbadan, penderitaseringtidakmakansamasekaliuntuksatu kali waktumakan, misalnyatidakmakanmalam. Upayademikiantidakakanmembawahasil yang memuaskandalamupayamenurunkanberatbadanbahkanseringhanyamenimbulkan rasa tidaknyaman, yang akhirnyamerangsangseleramakansehinggapadawaktumakanberikutnyaakanlebihbanyakmakanan yang dimakan. Menghilangkanmakanpagisangattidakdianjurkankarenabukansajamenyebabkantidakdapatbekerjasecaraefisienpadasiangharinya, tetapijugamendorongtimbulnya rasa lapar yang hebatpadasiangharinya. Diet yang diberikankepadapenderitaobesitashendaknyadalamwakturelatifpendekdapatmemperlihatkanhasilberupapenurunanberatbadan. Jikatidak, penderitaakanmerasasegandanakhirnyaberhentimenjalanidietnya. Penderitaobesitascenderungsenangmenggunakanpreparat yang dapatmenekannafsumakan. Preparattersebutselainmemberikanpengaruh yang bersifatsementara, tidakjarangmembawapengaruhsampingan. Penggunaanpreparatpenekannafsumakanjarangsekalimemberikanhasil yang memuaskandalamupayapenurunanberatbadan. 4. Makanan yang dianjurkanbagipenderitaobesitas Cairanseperti air dan jus yang dapatmembantumembuangsisametabolismedidalamtubuh. Karbohidratkomplekssepertikentang, beras, dankacang-kacangansebagaisumberenergidan vitamin. Sayurandanbuah-buahansebagaipenyumbang vitamin dan mineral. Berbagaijenisikandanprodukunggastanpakulituntukmemperolehmakanan yang tinggi protein serta mineral. Produksusurendahlemaksebagaipenyumbang vitamin dan mineral. 5. Makanan yang harusdihindari makanandalamjumlahbanyak tinggikandunganlemak gula alkohol. Berikutinibeberapacontoh diet yang dapatdigunakanolehpenderitaobesitas : Diet I Kandungankalori= 1000 kal : Berasataupenukarnya 70 g Dagingataupenukarnya 100 g Tempe ataukacang-kacangan 50 g Sayurancampuran 400 g Buah-buahan 400 g Minyak 10 g Akandiperoleh: Kalori 1050 kal Protein 43 gr Zatkapur 0,5 gr Zatbesi 25 mg Vit A 1500 SI Vit C 250 mg Diet II Kandungankalori= 1200 kal : Berasataupenukarnya 70 g Dagingataupenukarnya 100 g Tempe ataukacang-kacangan 100 g Ikansegarataugantinya 50 g Sayurancampuran 400 g Buah-buahan 400 g Minyak 10 g Akandiperoleh: Kalori 1200 kal Protein 51 g Lemak 25 g Zatkapur 0,5 g Zatbesi 20 mg Vit A 19000 SI Vit C 230 mg Setelahdiketahuisusunan menu bagipenderitaobesitas, makadapatdisusun menu bagipenderitatersebut. Pengaturan menu yang baikdanmengikutianjuran yang benar, akanmembantumenurunkanberatbadanpenderita. Olehkarenaitubeberapabahanmakanan yang tidakdianjurkanperludiwaspadaipenggunaannya. Namunsebaliknyamakanan yang dianjurkan, sepertisumberserat yang tinggidanrendahkandungankaloridanlemak, akansangatmembantumempercepattercapainyaberatbadan yang normal.