20 likes | 25 Views
Mouse Anti-ADAM17 Monoclonal Antibody.<br><br>https://www.creative-diagnostics.com/ADAM17-antibody-59613-144.htm<br>
E N D
Anti-ADAM17 monoclonal antibody, clone 2G7 Anti-ADAM17 monoclonal antibody, clone 2G7 (DMABT-H12989) (DMABT-H12989) This product is for research use only and is not intended for diagnostic use. PRODUCT INFORMATION PRODUCT INFORMATION Product Overview Product Overview Mouse Anti-ADAM17 Monoclonal Antibody Target Target ADAM17 Immunogen Immunogen ADAM17 (NP_003174, 215 a.a. ~ 314 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Isotype Isotype IgG2b Source/Host Source/Host Mouse Species Reactivity Species Reactivity Human Clone Clone 2G7 Conjugate Conjugate Unconjugated Applications Applications WB, IHC, sELISA, ELISA Sequence Similarities Sequence Similarities RADPDPMKNTCKLLVVADHRFYRYMGRGEESTTTNYLIELIDRVDDIYRNTSWDNAGFKGYGIQI EQIRILKSPQ EVKPGEKHYNMAKSYPNEEKDAWDV Size Size 1 ea Buffer Buffer In 1x PBS, pH 7.2 Storage Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. GENE INFORMATION GENE INFORMATION Gene Name Gene Name ADAM17 ADAM metallopeptidase domain 17 [ Homo sapiens ] Official Symbol Official Symbol ADAM17 Synonyms Synonyms ADAM17; ADAM metallopeptidase domain 17; TACE, tumor necrosis factor, alpha, converting enzyme; disintegrin and metalloproteinase domain-containing protein 17; CD156B; cSVP; TNF- alpha convertase; snake venom-like protease; TNF-alpha converting enzyme; ADAM metallopeptidase domain 18; tumor necrosis factor, alpha, converting enzyme; CSVP; TACE; 45-1 Ramsey Road, Shirley, NY 11967, USA Email: info@creative-diagnostics.com Tel: 1-631-624-4882 Fax: 1-631-938-8221 1 © Creative Diagnostics All Rights Reserved
NISBD; ADAM18; Entrez Gene ID Entrez Gene ID 6868 mRNA Refseq mRNA Refseq NM_003183 Protein Refseq Protein Refseq NP_003174 MIM MIM 603639 UniProt ID UniProt ID B2RNB2 Chromosome Location Chromosome Location 2p25 Pathway Pathway Activated NOTCH1 Transmits Signal to the Nucleus, organism-specific biosystem; Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Cytokine Signaling in Immune system, organism-specific biosystem; Delta-Notch Signaling Pathway, organism-specific biosystem; Disease, organism-specific biosystem; Epithelial cell signaling in Helicobacter pylori infection, organism-specific biosystem; Function Function PDZ domain binding; SH3 domain binding; integrin binding; interleukin-6 receptor binding; metal ion binding; metalloendopeptidase activity; metalloendopeptidase activity; metallopeptidase activity; metallopeptidase activity; metallopeptidase activity; peptidase activity; protein binding; zinc ion binding; 45-1 Ramsey Road, Shirley, NY 11967, USA Email: info@creative-diagnostics.com Tel: 1-631-624-4882 Fax: 1-631-938-8221 2 © Creative Diagnostics All Rights Reserved