betty_james
Uploaded by
23 SLIDES
552 VIEWS
230LIKES

Protein Structure

DESCRIPTION

Protein Structure. Protein Functions. Three examples of protein functions Catalysis: Almost all chemical reactions in a living cell are catalyzed by protein enzymes. Transport: Some proteins transports various substances, such as oxygen, ions, and so on.

1 / 23

Download Presentation

Protein Structure

An Image/Link below is provided (as is) to download presentation Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author. Content is provided to you AS IS for your information and personal use only. Download presentation by click this link. While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server. During download, if you can't get a presentation, the file might be deleted by the publisher.

E N D

Presentation Transcript


  1. Protein Structure

  2. Protein Functions • Three examples of protein functions • Catalysis:Almost all chemical reactions in a living cell are catalyzed by protein enzymes. • Transport:Some proteins transports various substances, such as oxygen, ions, and so on. • Information transfer:For example, hormones. Alcohol dehydrogenase oxidizes alcohols to aldehydes or ketones Haemoglobin carries oxygen Insulin controls the amount of sugar in the blood

  3. R NH3+ C COO- H Amino acid: Basic unit of protein Different side chains, R, determine the properties of 20 amino acids. Amino group Carboxylic acid group An amino acid

  4. 20 Amino acids Leucine (L) Isoleucine (I) Valine (V) Alanine (A) Glycine (G) Proline (P) Asparagine (N) Methionine (M) Tryptophan (W) Phenylalanine (F) Tyrosine (Y) Threonine (T) Serine (S) Cysteine (C) Glutamine (Q) Histidine (H) Glutamic acid (E) Arginine (R) Asparatic acid (D) Lysine (K) White: Hydrophobic,Green: Hydrophilic,Red: Acidic,Blue: Basic

  5. Each protein has a unique structure! Amino acid sequence NLKTEWPELVGKSVEEAKKVILQDKPEAQIIVLPVGTIVTMEYRIDRVRLFVDKLD Folding!

  6. Protein Structure Primary Secondary Tertiary Quaternary Assembly Folding Packing Interaction S T R U C T U R E P R O C E S S

  7. Protein Assembly • occurs at the ribosome • involves polymerization of amino acids attached to tRNA • yields primary structure

  8. Primary Structure primary structure of human insulin CHAIN 1: GIVEQ CCTSI CSLYQ LENYC N CHAIN 2: FVNQH LCGSH LVEAL YLVCG ERGFF YTPKT • linear • ordered • 1 dimensional • sequence of amino acid polymer • by convention, written from amino end to carboxyl end • a perfectly linear amino acid polymer is neither functional nor energetically favorable  folding!

  9. Protein Folding • occurs in the cytosol • involves localized spatial interaction among primary structure elements, i.e. the amino acids • yields secondary structure

  10. Secondary Structure • non-linear • 3 dimensional • localized to regions of an amino acid chain • formed and stabilized by hydrogen bonding, electrostatic and van der Waals interactions

  11. Secondary structure α-helix β-sheet Secondary structures, α-helix and β-sheet, have regular hydrogen-bonding patterns.

  12. Protein Packing • occurs in the cytosol (~60% bulk water, ~40% water of hydration) • involves interaction between secondary structure elements and solvent • yields tertiary structure

  13. Tertiary Structure • non-linear • 3 dimensional

  14. Protein Interaction • occurs in the cytosol, in close proximity to other folded and packed proteins • involves interaction among tertiary structure elements of separate polymer chains

  15. Quaternary Structure • non-linear • 3 dimensional

  16. 3D structure of proteins Tertiary structure Quaternary structure

  17. Class/Motif • class = secondary structure composition, • e.g. all , all , / , + • motif = small, specific combinations of secondary structure elements, • e.g. -- loop • both subset of fold /

  18. Fold • fold = architecture = the overall shape and orientation of the secondary structures, ignoring connectivity between the structures, • e.g. / barrel, TIM barrel • subset of fold families/superfamilies

  19. Fold families/Superfamilies • fold families = categorization that takes into account topology and previous subsets as well as empirical/biological properties, e.g. flavodoxin • superfamilies = in addition to fold families, includes evolutionary/ancestral properties CLASS: + FOLD: sandwich FOLD FAMILY: flavodoxin

  20. Hierarchical nature of protein structure Primary structure (Amino acid sequence) ↓ Secondary structure (α-helix, β-sheet) ↓ Tertiary structure (Three-dimensional structure formed by assembly of secondary structures) ↓ Quaternary structure (Structure formed by more than one polypeptide chains)

  21. Protein structure and its function Antibody Hormone receptor Example of enzyme reaction substrates A enzyme enzyme B Matching the shape to A Digestion of A! enzyme A Binding to A

  22. Protein structure prediction has remained elusive over half a century “Can we predict a protein structure from its amino acid sequence?” Now, impossible!

  23. Summary • Proteins are key players in our living systems. • Proteins are polymers consisting of 20 kinds of amino acids. • Each protein folds into a unique three-dimensional structure defined by its amino acid sequence. • Protein structure has a hierarchical nature. • Protein structure is closely related to its function. • Protein structure prediction is a grand challenge of computational biology.

More Related
SlideServe
Audio
Live Player
Audio Wave
Play slide audio to activate visualizer