1 / 21

TsetseEP Molecule: Key in Trypanosome Infection Control

TsetseEP molecule limits trypanosome infection of tsetse midguts. Learn about its impact on the immune response and trypanosome prevalence following knockdown. Research by Mike Lehane, Liverpool School of Tropical Medicine.

reese
Download Presentation

TsetseEP Molecule: Key in Trypanosome Infection Control

An Image/Link below is provided (as is) to download presentation Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author. Content is provided to you AS IS for your information and personal use only. Download presentation by click this link. While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server. During download, if you can't get a presentation, the file might be deleted by the publisher.

E N D

Presentation Transcript


  1. A immune-response molecule which limits trypanosome infection of tsetse midguts. Mike Lehane Liverpool School of Tropical Medicine

  2. Midgut establishment 1. Complex differentiation to asymmetric dividing epimastigote+ migration 2. T. brucei development in the tsetse fly 3. Metacyclogenesis

  3. Cardia Salivary Gland Midgut Successful infection

  4. Infection fails in the midgut

  5. Mean +/- S.E.M. % trypanosome prevalence 1st 2nd 3rd 4th >90% of laboratory midgut Infections fail Midgut infection success rates 70 10 30+ Blood meal

  6. The fly immune system affects trypanosome establishment in the midgut NS NSNS P<.0.01 P< 0.05 Trypanosome prevalence PBS LPSE.coli M.luteusPTG Laminarin

  7. Glossina gene discovery (EST programs) Head library and fat body library will soon be available within GeneDB making the EST much more useful to the research community LSTM, Sanger, Yale and TIGR

  8. Injection of : 1. Gmm2412 dsRNA 2. Ampicillin dsRNA 3. PBS 1 2 3 Gmm2412 GAPDH Development of suitable tools (RNAi) Injection of : 1. Gmm2412 dsRNA 2. NFW Injection of : 1. TsetseEP dsRNA 2. NFW 3. non-injected 1 2 Gmm2412 GAPDH 1 2 3 TsetseEP GAPDH

  9. Trypanosoma brucei EPprocyclin TsetseEP

  10. Trypanosome prevalence following knockdown (RNAi) of tsetseEP

  11. Where is TsetseEP produced?

  12. Is TsetseEP immune responsive? • 2D gels of midgut protein: • A. 3 days post injection with PBS • B. 3 days post injection with live E. coli K12RM148

  13. TsetseEP is present in all tsetse species investigated and is unique to Glossina. savannah riverine forest G. palpalis

  14. Summary • The tsetse fly immune response molecule TsetseEP affects the ability of trypanosomes to become established in the midgut of tsetse flies.

  15. LSTM • Lee Haines • Stella Lehane • Deidre Walshe • UVIC • Terry Pearson • Bristol • Wendy Gibson • Lori Peacock • Yale • Serap Aksoy • Sanger • Matt Berriman • TIGR / Liverpool • Neil Hall

  16. Candidate GenesMidgut lectins21 genes with carbohydrate recognition domains in EST libraries. • Gmm2412 cType signal sequence • Gmm3236 cType signal sequence • Gmm9056 galectin no-signal sequence • TsetseEP M. Chandra, M. Liniger, L. Tetley, I. Roditi, J. D. Barry, Insect Biochemistry And Molecular Biology 34, 1163 (Nov, 2004).

  17. Trypanosome prevalence following knockdown (RNAi) of Lectins Gmm2412 no effect Gmm3236 no effect Gmm9056 no effect

  18. Trypanosome prevalence following knockdown (RNAi) of Lectins TsetseEP strong effect

  19. Trypanosoma brucei EPprocyclin Trypanosoma congolense GARPprocyclin MTTTMSRVLHLMTVTLLCARVGMGQASDDDDCGGQSIPQKVEEVQTMCD VVQQLRALETASQSAVASVVAFAREASEAKERAEKAVERAKSKKRGVDAA TEAAARATAAAQRAETVVSDARKHAADLTAASKDAIETADESLRLLATCEKA DEPIRTAAEKCTGAAAEVTSKSLESAFDALAELLPDGADEIREHGAVFVVGLK SLEDDV RTAGEAKSEAEKAEGDANDAADGARAVLTGVCVLLLLAALH

  20. Binding to the trypanosome surface? TsetseEP Antibody X

  21. Does TsetseEP knockdown affect the prevalence of T. congolense?

More Related