slide1 n.
Download
Skip this Video
Loading SlideShow in 5 Seconds..
Pengurusan Stres Produktiviti Kerja PowerPoint Presentation
Download Presentation
Pengurusan Stres Produktiviti Kerja

Loading in 2 Seconds...

play fullscreen
1 / 74

Pengurusan Stres Produktiviti Kerja - PowerPoint PPT Presentation


  • 197 Views
  • Uploaded on

Pengurusan Stres Produktiviti Kerja. Apakah perkara yang menyebabkan anda STRES ?. 1. Ujian sesama manusia menjadi musuh

loader
I am the owner, or an agent authorized to act on behalf of the owner, of the copyrighted work described.
capcha
Download Presentation

PowerPoint Slideshow about 'Pengurusan Stres Produktiviti Kerja' - kelli


An Image/Link below is provided (as is) to download presentation

Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author.While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server.


- - - - - - - - - - - - - - - - - - - - - - - - - - E N D - - - - - - - - - - - - - - - - - - - - - - - - - -
Presentation Transcript
slide3

1. Ujiansesamamanusiamenjadimusuh

Tho ha: 123-124Allah berfirman: “TurunlahkamuberduadariSyurgaitu, bersama-sama, dalamkeadaansetengahkamumenjadimusuhbagisetengahnya yang lain; kemudianjikadatangkepadakamupetunjukdariKu, makasesiapa yang mengikutpetunjukKuitunescayaiatidakakansesatdania pula tidakakanmenderitaazabsengsara.“Dan sesiapa yang berpalingingkardariingatandanpetunjukKu, makasesungguhnyaadalahbaginyakehidupan yang sempit, danKamiakanhimpunkandiapadaharikiamatdalamkeadaanbuta”.

slide4

2. Pasangansebagaimusuh.

At Taghabun:14-15 “Wahaiorang-orang yang beriman! Sesungguhnyaadadiantarapasangankamudananak-anakkamu yang menjadimusuhbagikamu; olehituawaslahsertaberjaga-jagalahkamuterhadapmereka. Dan kalaukamumemaafkandantidakmarahkan (mereka) sertamengampunkankesalahanmereka (maka Allah akanberbuatdemikiankepadakamu), keranasesungguhnya Allah MahaPengampun, lagiMahaMengasihani.”

3. Harta Benda danAnaksebagaiujian

At Taghabun:15 “Sesungguhnyahartabendakamudananak-anakkamuituhanyalahmenjadiujian, dandisisi Allah jualahpahala yang besar.”

slide5

KenalDenganOrang Lain, KurangStres

Hujurat: 13 ”Wahaiumatmanusia! SesungguhnyaKamitelahmenciptakankamudarilelakidanperempuan, danKamitelahmenjadikankamuberbagaibangsadanbersukupuak, supayakamuberkenal-kenalan (danberamahmesraantarasatudengan yang lain).

slide6

2. Kenali Motif Saya

A = Iamemberisayapendapatan yang tetap

B = Iamemberisayakeuntungandengancepat

C = Iadapatmenolongsayaberdampingdengankeluargadankawan-kawanlebihmesra

D = Iatidakmelibatkanrisiko yang tinggi

E = Iamemberisayareputasi yang tinggididalammasyarakat

F = Iamemberisayakebebasandidalamkerja

G = Iamerupakansatupekerjaan yang mencabar

H = Iamembuatsayaterkenal

I = Iadapatmemberisayamasalapang yang mencukupiuntukmenghiburkanhatisaya

J = Iamemberikeluargasayamasadepan yang cerahsetelahbersara

K = Iamemberisayapeluanguntukberdampingdenganrakan yang secocokdengansaya

slide7

1.2 Pilihsatudaripadaduajenispekerjaan yang diberi. Nyatakansebab-sebabpilihanandaitudansenaraikanmengikutmustahaknyakepadadirianda.

PilihanpekerjaanSebab-sebab

………………………………………………………………………….

1. ___MengajardiUniversitiUtama = ___ = 3

___BerniagaKedua = ___ = 2

Ketiga= ___ = 1

-------------------------------------------------------------------------------------

2. ___ MenjualUtama = ___ = 3

___ PerkilanganKedua= ___ = 2

Ketiga= ___ = 1

………………………………………………………………………….

3.___ MenjadiPemborongUtama = ___ = 3

___ MembukapasarayaKedua = ___ = 2

Ketiga= ___ = 1

…………………………………………………………………………..

4. ___ MengurussatuperniagaanUtama = ___ = 3

___ MenguruspelbagaiperniagaanKedua = ___ = 2

Ketiga= ___ = 1

………………………………………………………………………….

5. ___ AgensikepadabarangkeperluanharianUtama = ___ = 3

___ PengeluarbarangkeperluanharianKedua= ___ = 2

Ketiga= ___ = 1

…………………………………………………………………………..

…………………………………………………………………………..

3. SoalanPilihKerja

slide8

3. SoalanPilihKerja

…………………………………………………………………………..

6.___ PengarahsebuahinstitusiUtama = ___ = 3

___ PengarahJabatanMasyarakatKedua = ___ = 2

Ketiga= ___ = 1

…………………………………………………………………………..

7.___ MembuatfilemUtama = ___ = 3

___ Menjalankankerja-kerja Agama Kedua = ___ = 2

Ketiga= ___ = 1

…………………………………………………………………………..

slide9

3. SoalanPilihKerja

8. ___ PensyarahUniversitiUtama = ___ = 3

___ PenyelidikKedua = ___ = 2

Ketiga= ___ = 1

…………………………………………………………………………….

9. ___ MembuatfilemUtama= ___ = 3

___ BerniagaKedua = ___ = 2

Ketiga= ___ = 1

……………………………………………………………………………

10. ___ PensyarahUniversitiUtama = ___ = 3

___ PenjualKedua = ___ = 2

Ketiga= ___ = 1

…………………………………………………………………………..

11.___ PengilangUtama = ___ = 3

___ PengarahJabatanMasyarakatKedua = ___ = 2

Ketiga= ___ = 1

……………………………………………………………………………

12. ___ AhliPolitikUtama= ___ = 3

___ PakarPenyelidikKedua = ___ = 2

Ketiga= ___ = 1

……………………………………………………………………………..

13. ___ PengarahJabatanMasyarakatUtama = ___ = 3

___ AhliPolitikKedua= ___ = 2

Ketiga= ___ = 1

…………………………………………………………………………….

slide10

4 Pengiraan Motif

Motif Dominan Saya ialah::

……………………………………………………………………………………………………………….........................

………………………………………….

slide11

StrategiTanganiStres

Kompeten

Positif

Proaktif

HormatdanHargaiKejantanannya

HormatdanBelaiKewanitaannya

5 AyatCinta

KurangkanCortisol

Tingkatkan

Oxytocin Testosterone

Kuatkan Akal denganilmudanamalanDuniadanAkhirat

Test Stress

reaksi tubuh semasa stres kapal terbang landing atas kereta3
ReaksiTubuhSemasaStres“Kapalterbang landing ataskereta"

Guladalamdarahdigunakan

Tetapilemaktidakdisentuh.

reaksi tubuh semasa stres kapal terbang landing atas kereta4
ReaksiTubuhSemasaStres“Kapalterbang landing ataskereta"

BadanmengeluarkansemulaTestosteronedanOxytocin

2 tingkatkan ketahanan lelaki dengan hormon testosterone
2. TingkatkanKetahanan: LelakidenganhormonTestosterone
  • Hormonasas sex lelaki yang menentukankejantananmereka - penguasaan, kekuatanfizikaldanemosi, bentukbadan, bulubadan, suaragarau, bauhangitdankekuatanseksual.
  • Hormoninijugamempengaruhiketegasan, pertandingan, kreativiti, kepintarandankecekapan.
  • Hormonini 20-30% lebihbanyakdalamlelakidaripadawanita.
  • Lelakimemerlukantahaphormonini yang sesuaiuntukmengawaldanmenguasaistres.
  • Kesanpositifjikatahapsesuaiialah:
    • Mengecapikejayaan
    • Merasaikebanggaan
    • Puasdapatapa yang diinginkan
    • Mengecapikemenangan
  • Jikahormoninikurangdalamlelaki, akibatnyaialah
    • Rasa kecewa
    • Rasa lemah
    • Rasa gagalmencapaisesuatuidaman
2 tingkatkan ketahanan lelaki dengan hormon testosterone1
2. Tingkatkan Ketahanan: Lelaki dengan hormon Testosterone
  • Suasana, keadaandanaktiviti yang merangsanghormon testosterone Lelakiialah
  • Penetapanmatlamat- Pertandingan – Menyelesaimasalah - Pertanggungjawapan - Menghadapirisiko - Keadaanbahaya - Penguasaan - Kejayaan - Kecekapan - Aktiviti yang segera - Wang - Keputusan - Untung/Rugi - Kuasa.

Kerja Last Minute

slide21

ROH

Al Haj: 5

unsur manusia
UnsurManusia

PembuatKeputusan

Qalbu

PaksaLogik

Nasihat Lateral

Kemahiran

Akal

Nafsu

Ilmu dan Amalan Agama

Roh

Jasad

Makanan

Al Jathiyah: 23Dengan yang demikian, bagaimanafikiranmu (wahai Muhammad) terhadaporang yang menjadikanhawanafsunya: tuhan yang dipatuhinya, dania pula disesatkanoleh Allah keranadiketahuiNya (bahawaiatetapkufuringkar), danditutup pula ataspendengarannyadanhatinya, sertadiadakanlapisanpenutupataspenglihatannya? Makasiapakahlagi yang dapatmemberihidayahpetunjukkepadanyasesudah Allah (menjadikandiaberkeadaandemikian)? Olehitu, mengapakamu (wahaiorang-orang yang ingkar) tidakingatdaninsaf?

Ilmu Dunia + Budaya Hidup

Tergesa-gesa, Mudah, Seronok, Marah, Benci, Dendam, Hasad, Diri Sendiri..

Tenang :Cabaran: Keredhaan, Sabar, Syukur, Benar, Patuh..

kesan berpuasa
Kesan Berpuasa

Bertaqwa

Qalbu

Nasihat

Kemahiran

Akal

Patuh

Beriman kepada Allah (Keampunan, Ganjaran..)

Nafsu

Jasad

Roh

Makanan

Ikuti Amalan Sebulan Ramadhan Sepenuhnya

Puasa – terawih – tadarus – iktikaf- Sedekah – Zakat Fitrah

slide24
Al Fatihah (Nur Irsyad)
  • Dengan menyebut namaMu Ya Allah, Yang Maha Pengasih Penyayang
  • Segala puji bagi Mu ya Allah, Pemelihara seluruh Alam Raya ,
  • Engkaulah Maha Pengasih dan Penyayang Yang Menguasai hari Pembalasan,
  • Hanyalah kepadaMu kami menyembah dan padaMu kami mohon pertolongan,
  • Tunjukanlah kami ke jalan yang lurus
  • Jalan orang-orang yang Engkau beri ni’mat; bukan jalan mereka yang kau murkai dan bukan pula jalan mereka yang sesat.
boys process more blood flow in the cerebellum boys attach their learning to physical movement

Four Lobes - Thinking

ACTIVE

Doing & physical action

Boys process more blood flow in the CerebellumBoys attach their learning to physical movement.
slide26

Girls

Woman emosi

Four Lobes - Thinking

Limbic System – emotion process

Brain Stem – Fight or Flight

slide27

PuncaStres

Ketidakpastian !

TidakFahamOrang Lain

Datelines

Keputusan Yang TidakDiingini

suami memimpin keluarg isteri mengurus keluarga
Suami Memimpin Keluarg Isteri Mengurus Keluarga

John Gray’s hypothesis,1993, “Men are from Mars Women are from Venus”.

suami memburu di hutan isteri menjaga rumah
Suami memburu di hutan, isteri menjaga rumah

Cinta Kukuh Apabila Suami Keluar Berburu..

Suami Rasa Dia Hebat..Rasa Diperlukan oleh Isteri

John Gray’s hypothesis,1993, “Men are from Mars Women are from Venus”.

isteri membalas cinta suami dgn menjaga anak dan menyediakan makanan suami
IsterimembalascintasuamidgnmenjagaanakdanmenyediakanmakanansuamiIsterimembalascintasuamidgnmenjagaanakdanmenyediakanmakanansuami
  • Sambil2:
  • Bersembang
  • Keluar mengutip buah, sayur, bijirin
  • Melayan anak2
  • Selesai… sembang lagi
sumbangan masing2 dihormati dan hargai
Sumbangan masing2 dihormati dan hargai

Suami Rasa Hebat.

Bertambah Sayangnya bila isterinya menyambut kepulangan.

Isteri tambah sayang sebab suami berkorban kerananya.

keperluan dan kehendak masing2 dipenuhi akhirnya masing2 mendapat hadiah
Keperluan dan kehendak masing2 dipenuhiAkhirnya Masing2 Mendapat Hadiah
  • Isteri sediakan makan malam
  • Suami cerita dengan anak2 kisah memburu
  • Suami relek dengan rakan mengadap api
  • Selepas makan, masuk tidur
  • Dapat Hadiah
  • Bertambah Kasih Mereka
suami memimpin mengurus isteri juga memimpin dan mengurus kekadang kelamkabut
SuamiMemimpinMengurusIsteriJugaMemimpindanMengurus , KekadangKelamkabut
  • Tiada penghargaan
  • Tiada penghormatan
  • Masing-masing membawa hal
slide40

MindaTenang

BadanSihatTegap

Testosterone

Seksual

Hari2mau

hormon lelaki
Testosterone

+ ve =

rasa berkuasa,

berjaya,

dapatselesaimasalah

dihormati.

Hormontinggiwaktupagi

Dalamkeadaanpertandingan

Makan – Main - Tidur

Hormonlelaki
tip jaga suami
Testosteron + ve =

rasa berkuasa(tunggukeputusannya)

berjaya, ( pujijikadiaberjaya)

dapatselesaimasalah(pujijikadptselesaikan)

dihormati. (sambutdiapulangdgn ceria)

Hormontinggiwaktupagi(masaptgtu berhati2)

Dalamkeadaanpertandingan(galakkandiabersukan)

BalikkerjaMakan – Main - Tidur

Tip jagasuami
hormon penting
Oxytocin

+ve =

biladipuji,

dihargai, (dapathadiahatauucap TQ)

dibelai,

shopping,

melayan org disayangi, (menyusubayi)

Dapatlayanandari org ygdisayangi

Kepuasan SEX

Hormonpenting
tip belai isteri
Oxytocin +ve =

biladipuji, (sentiasapujiapasaja)

dihargai, (berihadiahselalu)

dibelai, (pelukdan urut2 selalu)

shopping, (temandia shopping)

melayan org disayangi, (ucapterimakasih)

Layanandari org ygdisayangi (layankehendakdia)

Kepuasan SEX (usahakanpuaskandia)

Tip belaiisteri
bila mengadu untuk dapatkan sokongan

Fokus punca luaran, untuk rasa lega

Fokusdalaman, perasaan, sikap, emosi, untuk rasa lega

Bilamengaduuntukdapatkansokongan
cara beri sokongan kepada suami
Cara berisokongankepadasuami

Yang,abangkalahlah

main bola tadi

Padang basahkot

Abangtaksihatkot

Pengadiltakadilkot

Lawanhebatkot

bila isteri pula mengadu untuk dapatkan sokongan
Bilaisteri pula mengaduuntukdapatkansokongan

Abang, I dahbuatsilaplah

Eh bukansilap U..

slide49

Pengajaran Al Quran

MaryamMakaMaryamhamilahmengandungnya, laluiamemencilkandiridengankandungannyaitukesebuahtempat yang jauh. [22](Ketikaiahendakbersalin) makasakitberanakitumemaksanya (pergibersandar) kepangkalsebatangpohontamar (kurma); iaberkataalangkahbaiknyakalauakumatisebeluminidanmenjadilahakusesuatu yang dilupakanorangdantidakdikenang-kenang! [23]Laluiadiserudarisebelahbawahnya:” Janganlahengkauberdukacita(wahaiMaryam), sesungguhnyaTuhanmutelahmenjadikandibawahmusebatanganaksungai. [24]Dan gegarlahkearahmubatangpohontamaritu, supayagugurkepadamubuahtamar yang masak. [25]“Makamakanlahdanminumlahsertabertenanglahhatidarisegala yang merunsingkan. Kemudiankalauengkaumelihatseseorangmanusia, makakatakanlah: Sesungguhnyaakubernazardiammembisukerana (Allah) Ar-Rahman; (setelahakumenyatakan yang demikian) makaakutidakakanberkata-katakepadasesiapapundarikalanganmanusiapadahariini”. [26]

slide50

9. KaedahWanitaMeningkatkanOxytocinDalamBadannya

90 / 10

13. Pergi SPA

14. Urut facial

15. Join aerobic / poco2

16. Jalan2 dipantai

17. Dukungbayi

18. Gubahbunga

19. Baca buku

20. Menonton

Urutbadan

Mendandanrambut

Potong kuku (manicure)

Shopping dgnkawanwanita

Sembangdifon

Makansamadgnkawan

Masak sama2

Solatsunat

Hiasdankemasrumah

Dengarmuzik

Nyanyi

Dinner direstorenbersamafamili

kaedah suami tolong isteri meningkatkan oxytocinnya
KaedahSuamiTolongIsteriMeningkatkanOxytocinnya
  • Buatkan breakfast utknya
  • Tinggalkan nota " I love u"
  • Hadiahkandiasekuntumros
  • Pujibajubarunya
  • Bukakanpintuuntuknya
  • Rancangmakanangin
  • Ajakdia jalan2
  • Puji dia.. Diatetapcantik
  • Pelukbilabangunpagi
  • Pelukbilanakgikerja
  • Pelukbilabalikdarikerja
  • Peluksebelumtidur

13. Sidaikaintanpadisuruh

14. Pujikalaudiapakaitudungbaru

15. Berkebunbersamanya

16. Tolongbasuhpinggan

17. Urutkakinya

18. Basuhkeretanya

19. Ikutdia shopping

20. Sediakanpingganjikadiasedanghidanglauk.

jika isteri ajak jalan2 dia sedang stres duduk di rumah
Jikaisteriajak jalan2 = Diasedangstresdudukdirumah

1, JOM… nakkemana?

2. Kita berdua je ke?

3. Nakbawabekalke?

4. NakAbangpakaibajuapa?

5. Takbawatelekong? .. Kotlambatnanti

slide53

Setiapmanusiamempunyaisifatmarahdansabarsebenarnyaadalahpenghalangsifatitu. Bagaimanapun, kesabaranada had danbatasnya, apabilahilangsabarmakatimbullahkemarahan.

Menurut Imam al-Ghazali, sikapmarahialahnyalaanapi yang bersumberdaripadaapi Allah SWT yang menyaladanmenjulangtinggisampainaikkehati.

Ada lima kategorimarahiaitucepatmarahataumarahtidakbertempat, marahpertengahan (mampumengawalmarahnyaataumarahbertempat), marahsederhana, tidaktahumarahdanmarahketerlaluan.

Imam al-Ghazalimengatakan, ada 10 puncamenjadipenyebabsifatmarahiaitu rasa banggadiri, takjubkepadaperibadisendiri, berlebihandalamgurausendadanmelampauibatas, bercakapperkarasia-siaselaingemarmembuatfitnah.

Lima lagipuncanyaialahgemarberbantahdalamsesuatuperkara, khianat, tamakkepadahartajugapangkat, gagalmengendalikannafsudanemosisertahasaddengkiselainirihati.

Apabilaseseorangitumarah, pergerakanfizikalnyaturutberubah.Apikemarahan yang semakinmemuncakmenyebabkanpercakapannyamenjadikuat, kata-katatidakteratur, bahasanyalucah, kasardanbersifatmenghinajugamerendah-rendahkanorang yang dimarahdanpelbagailagi.

Marah yang dipujiadalahmarahpertengahaniaitumarahbertempat. Contoh, seorangbapamarahkepadaanaknya yang tidakmahubersolatataumenutupaurat. Rasulullah SAW mengajarkitadalamhadisnya: “Suruhlahanakkamubersolatketikaberumurtujuhtahundanpukullahmereka yang tidakmahubersolatketikaberumur 10 tahundanpisahkanmerekadaritempattidur

15. PengurusanMarah

Intipatinasihat Allah - Ali Imran [159]Makadengansebabrahmat (yang melimpah-limpah) dari Allah (kepadamuwahai Muhammad),

engkautelahbersikaplemah-lembutkepadamereka (sahabat-sahabatdanpengikutmu),

dankalaulahengkaubersikapkasarlagikerashati, tentulahmerekalaridarikelilingmu.

Olehitumaafkanlahmereka (mengenaikesalahan yang merekalakukanterhadapmu),

danpohonkanlahampunbagimereka,

danjugabermesyuaratlahdenganmerekadalamurusan (peperangandanhal-halkeduniaan) itu.

kemudianapabilaengkautelahberazam (sesudahbermesyuarat, untukmembuatsesuatu) makabertawakalahkepada Allah,

sesungguhnya Allah Mengasihiorang-orang yang bertawakalkepadaNya.

slide55

SemasaMarah

Four Lobes - Fikir

Limbic System – Prosesemosi

Brain Stem – LawanatauLari

slide56

SemasaMarah

MindaPerempuanDarahKeatas - Berfikir

Four Lobes - Fikir

Limbic System – Prosesemosi

Brain Stem – LawanatauLari

slide57

SemasaMarah

MindaLelakiDarahKeBawah - Bertindak

Four Lobes - Fikir

Limbic System – Prosesemosi

Brain Stem – LawanatauLari

slide58

KawalMarah

KawalDarahNaikkeatas - Berfikir

Four Lobes - Fikir

Limbic System – Prosesemosi

Brain Stem – LawanatauLari

slide59

Allah SWT pujukNabi SAW supayaberfikir . Surah Ali Imran

Muladgn [139]Dan janganlahkamumerasalemah (dalamperjuanganmempertahandanmenegakkan Islam), danjanganlahkamuberdukacita (terhadapapa yang akanmenimpakamu), padahalkamulahorang-orang yang tertinggi (mengatasimusuhdenganmencapaikemenangan) jikakamuorang-orang yang (sungguh-sungguh) beriman.

Hingga[169] masihnasihatlagi.Dan jangansekali-kali engkaumenyangkaorang-orang yang terbunuh (yang gugurSyahid) padajalan Allah itumati, (merekatidakmati) bahkanmerekaadalahhidup (secaraistimewa) disisiTuhanmerekadenganmendapatrezeki;

slide60

Intipatinasihat Allah - Ali Imran [159]Makadengansebabrahmat (yang melimpah-limpah) dari Allah (kepadamuwahai Muhammad),

engkautelahbersikaplemah-lembutkepadamereka (sahabat-sahabatdanpengikutmu),

dankalaulahengkaubersikapkasarlagikerashati, tentulahmerekalaridarikelilingmu.

Olehitumaafkanlahmereka (mengenaikesalahan yang merekalakukanterhadapmu),

danpohonkanlahampunbagimereka,

danjugabermesyuaratlahdenganmerekadalamurusan (peperangandanhal-halkeduniaan) itu.

kemudianapabilaengkautelahberazam (sesudahbermesyuarat, untukmembuatsesuatu) makabertawakalahkepada Allah,

sesungguhnya Allah Mengasihiorang-orang yang bertawakalkepadaNya.

فَبِمَا رَحۡمَةٍ۬ مِّنَ ٱللَّهِ لِنتَ لَهُمۡ‌ۖ وَلَوۡ كُنتَ فَظًّا غَلِيظَ ٱلۡقَلۡبِ لَٱنفَضُّواْ مِنۡ حَوۡلِكَ‌ۖ فَٱعۡفُ عَنۡہُمۡ وَٱسۡتَغۡفِرۡ لَهُمۡ وَشَاوِرۡهُمۡ فِى ٱلۡأَمۡرِ‌ۖ فَإِذَا عَزَمۡتَ فَتَوَكَّلۡ عَلَى ٱللَّهِ‌ۚ إِنَّ ٱللَّهَ يُحِبُّ ٱلۡمُتَوَكِّلِينَ ()

slide62

In a study of nearly 100 boys, those with lower levels of omega-3 fatty acids demonstrated more learning and behavioral problems (such as temper tantrums and sleep disturbances) than boys with normal omega-3 fatty acid levels. Low levels of omega-3 fatty acids have been shown to lower the concentration of certain brain chemicals (such as dopamine and serotonin) related to attention and motivation.

slide65
10. “The Five Love Languages” : Mengukuhkanperbezaanmemenuhipelbagaikehendak. BinaPasukan Di Rumah (Dr Gary Chapman)
menangani stres hasil kerja dengan pelanggan
MenanganiStresHasilKerjaDenganPelanggan

KeperluandanKehendak SOP

.............................................................................................................................................................................................................................................................................................

KeperluandanKehendakSaya

.............................................................................................................................................................................................................................................................................................

KeperluandanKehendakDipersetujuiBersama

.............................................................................................................................................................................................................................................................................................

KeperluandanKehendakKetua

.............................................................................................................................................................................................................................................................................................

AliranKerja / KPI / SOP baru

.................................................................................................................................................................................................................................................................................

competency at work
Competency at work

System

  • Competency-based performance is a current concept in business and government. One comprehensive definition of "competency" is: "A cluster of related knowledge, skills, and attitudes that affects a major part of one’s job (a role or responsibility), that correlates with performance on the job, that can be measured against well-accepted standards, and that can be improved via training and development." (Training magazine: July, 1996)
  • An "essential" competency is critical for an employee to perform effectively at his or her level in an NPS Career Field. A "universal" competency is one that is required of all NPS employees regardless of Career Field. An example of a universal competency would be "comprehension of the NPS’ Mission." 
  • Competencies are gained through a multitude of ways—life experience; formal education; apprenticeship; on-the-job experience; self-help programs; and, yes, training and development programs. All of these together contribute to job competence in an employee. Ultimately, supervisors and employees working together and assessing consistency of job performance (behaviors) over time determine overall "employee competence." 
  • When choosing training and development activities to help you achieve competencies identified for your job, target competencies – not courses.
  • KPI (Key Performance Indicator)
    • Blue = Beyond expectation
    • Green = Meet expectation
    • Yellow = Below expectation
    • Red = Not satisfactory Need urgent improvement

Technology

Stress

Enviroment

People

A Fishbone Diagram is another name for the Ishikawa Diagram or Cause and Effect Diagram. It gets its name from the fact that the shape looks a bit like a fish skeleton. A fish bone diagram is a common tool used for a cause and effect analysis, where you try to identify possible causes for a certain problem or event. The following printable cause and effect diagrams and fishbone diagram template may help you get started, and if you continue reading, I've included some detailed information about how to use the diagram.

11 komunikasi 2 hala mengurangkan stres penerima
11. Komunikasi 2- hala mengurangkan stres penerima

Definisi Komunikasi

1.1 Komunikasi didefinisikan sebagai satu proses pemindahan mesej oleh seseorang individu kepada individu lain dengan bertujuan untuk mempengaruhi tingkahlaku individu tersebut. 

1.2 Komunikasiialahpemancaran idea darisatupemikirankepadasatupemikiran lain.

(Highet)

1.3 Jikakomunikasisehalasahaja, kemungkinanpenerimatidakdapatsepenuhnyaapa yang ingindisampaikanolehpenyampai. Walaupuntugaspenyampaitelahselesai. Tetapipenerimaakantertekankeranatidakmemahamimesejtersebut.

1.4 Komunikasi 2 halabolehmeninggikanketepatanmesejdanmengurangkanstresnyaapalagimendapatpengesahandaripadapenyampainya.

1.5 Silaamalkankomunikasi 2 haladirumahbersamaanak-anak. “Silaulangsebutsatupersatuapa yang akanAdikbuat……. “

1.6 Jikaandastafbawahankepadaketua, “Terimakasihbos, silabetulkansaya, sayaakan ………….”

Simulasi 1. Memahami pembaca berita radio.

Seorang peserta (pembaca berita) diminta ke hadapan membacakan lukisan yang diberikan kepadanya. Peserta (pendengar radio) yang lain mendengar dengan teliti dan terus melukiskan di atas kertas. Hasil lukisan dinilai selepas pembaca berita selesai membaca. Komunikasi hanya sehala.

Dijemput peserta kedua membaca lukisan kedua. Kali ini peserta dibenarkan bertanya dan pembaca dibenarkan menjawab tetapi hanya lisan tanpa gerak badan. Hasil lukisan oleh peserta-peserta dinilai dan dibandingkan dengan lukisan pertama.

Perbezaan keduanya dibincangkan dari sudut model komunikasi.

slide70

12. “The Five Love Languages” : Mengukuhkan perbezaan memenuhi pelbagai kehendak. Bina Pasukan Di Rumah – Produktif Tempat Kerja (Dr Gary Chapman)

13 simulasi bina kapal
13. Simulasi Bina Kapal
  • Pekerja yang kompeten (buat kerja mengikut spesifikasi dan dengan cepat) adalah yang kurang stres. Bagaimana anda?
  • Bila ada seorang pekerja yang kurang kompeten, ini akan menyebabkan ketua dan teman-teman yang lain menjadi stres?
  • Pastikan kursus yang anda pohon tepat meningkatkan kompetensi kerja bukan hanya untuk mencukupkan korta sahaja.
  • Punca sebenar yang kami hadapi jika dikaitkan dengan isu di tempat kerja ialah:
  • Pengajaran dari sudut spiritual ialah:
14 pengurusan konflik mengenai kualiti kerja di pejabat
14. Pengurusan Konflik Mengenai Kualiti Kerja Di Pejabat.

Mula

  • Pengenalan
  • Perbezaan pendapat adalah suatu yang biasa dalam sesuatu organisasi atau kumpulan. Apabila manusia dari pelbagai latar belakang ingin membuat suatu keputusan bersama mereka dijangka akan menhadapi satu masalah iaitu ketidak sepakatan dalam membuat keputusan. Dalam mencari jalan penyelesaian terhadap kewujudan konflik ini, ia mungkin akan membawa kepada pertambahan kekuatan organisasi atau tindakan mereka akan menjadi lebih berkesan.
  • Kelahiran konflik amat berkait rapat dengan kewujudan perhubungan manusia. Jenis-jenis perhubungan yang boleh menerbitkan konflik ialah :
    • i. Percanggahan keinginan atau matlamat
    • ii. Perbezaan idea tentang cara atau kaedah pencapaian matlamat
    • iii. Ketidak fahaman atau nilai dan perasaan peribadi yang tersembunyi
  • Mencari Kesepakatan Melalui “Standard Operating Procedures” SOP.
  • Dalam menyelesaikan kewujudan konflik, semua pihak harus mencari satu kesepakatan dalam mencari matlamat dan kepentingan yang boleh dikongsi bersama.
  • Ini merupakan asas kepada penyelesaian percanggahan yang wujud. Membangkitkan isu dalam bentuk persoalan biasanya akan memudahkan jalan penyelesaian yang mampu memuaskan hati semua pihak. Perkara-perkara berikut amat membantu seseorang untuk :
  • · Mengenalpasti dan sedar akan percanggahan yang wujud
  • · Bimbingan terbuka, komunikasi berkesan dan aktif mendengar
  • · Kekal pada objektif utama, misalnya kepada PROSES KERJA dan bukan kepada individu
  • · Cari satu persetujuan bersama mengenai kualiti kerja (Merah = Sgt Tidak memuaskan, Kuning = Dibawah Jangkaan, Hijau = Capai Jangkaan, Biru = Melebihi Jangkaan.
  • · Jika perlu buat pengubahsuaian, misalnya bagi mendapat kepastian dan keputusan.
  • · Perlu diingatkan bahawa percanggahan idea boleh membawa kepada kumpulan yang lebih mantap dan efektif
  • Tentukan bersama ketua mengenai Tugas Wajib, Sunat, Harus di pejabat dan susunlah urusan anda berdasarkan turutan keutamaan mengikut fekah ini.
  • Paparkan tanda Merah = Sedang melaksanakan kerja Wajib, Kuning = sedang laksana tugas Sunat dan Hijau = sedang rehat bersedia untuk membantu rakan-rakan sekerja.

Tamat

slide73

15. Komunikasi Tugasan: “Management by Visual” – pamerkan “to do list” dibelakang meja atau ruang notis anda” dan dapatkan persetujuan boss

Senarai tugas tidak sesuai di dalam diari anda. Orang lain tidak dapat membacanya

Piawai kerja mesti digambarkan kualitinya agar mudah untuk menilai

Elok jika Senarai tugas tidak berserabut. Susah orang lain memahaminya

Senarai tugas tidak sesuai di dalam komputer

Senarai tugas sesuai dalam bentuk carta gantt

slide74

FasilitatorAnda: Ahmad ShafiaiUdaJaafarDekanFakultiPendidikanKolej UNITI Port Dickson

  • Master of Science in Development Training and Education, University of Wolverhampton (1995).
  • Bachelor of Science in Agriculture, Universiti Pertanian Malaysia (1987).
  • Certificate of Education Oversea Technical Teachers’ Awards, Polytechnic Wolverhampton (1979).
  • Diploma in Agriculture, Universiti Pertanian Malaysia (1977).
  • Pengalaman:
  • 1. Ringkasnya beliau banyak mengendalikan kursus Teambuilding II untuk jabatan kerajaan dan juga swasta seperti INSPEN, Pegawai-pegwai Farmasi Jab Kesihatan Negeri Sembilan, Pejabat Kesihatan Jempol, JPA, pegawai sokongan UUM dan Jab Sumber Manusia TNB. Kursus-kursus pengurusan seperti Komunikasi Kepimpinan untuk Pegawai Pejabat Kesihatan Hulu Langat dan Pegawai-pegawai Jab Penilaian Negara. Untuk pegawai sokongan UUM pula seperti Kursus Membuat keputusan, Perkhimatan Pelanggan Berkualiti dan Pengurusan Stress / Konflik. Selain latihan, beliau juga adalah perunding sistem pengurusan pendidikan kepada Jakarta Islamic School, Indonesia.
  • 2. Semasa menjadi CEO Madrasah Al Irsyad Al Islamiah, Singapura (2004-2007), secara terus menanamkan nilai IMAN, IHSAN dan ITQAN dikalangan guru-guru dan pegawai Madrasah melalui perbincangan, latihan dan kaunseling. Waktu yang sama menjadi ketua Irsyad International membantu membangun guru-guru Sekolah Irsyad Satyia, Bandung dan Jakarta Islamic School, Jakarta melalui latihan ITQAN dan perundingan.
  • 3. Pada 2000 – 2004 bersama dengan konsultan terkemuka di Malaysia mengendalikan Supervisor Management Development Programme for Alam Flora Sdn Bhd (People Management Module, Customer Relation Management Module and Operation Management Module); Young Muslim Singapore Leadership Program; and Train The Trainers Programme for Malaysia Airports Berhad, Standard People Practices for Selangor Medical Center Sdn Bhd staff. Value Integration Programme for Tabung Haji Properties Sdn Bhd staff. Developed and conducted Workshop "Lasting Love Husband-Wife Relationship" : MLNG Bintulu staff; Petronita East ZoneDeveloped and conducted value based programme "Ehsan: Penjana Kecemerlangan Warga Kerja" for Celcom Northern Region 2001.
  • 4. Bidang latihan adalah hobinya. Telah mengendalikan Train the Trainers for: Pos Laju and Pos Malaysia Bhd; Modenas; Ansell Kedah Sdn Bhd; Kontena Nasional; TDK (M) Sdn Bhd and Malaysia Airports Berhad.Conducted training on Dynamic Leadership Programme for Supervisors and Line Leaders: Western Digital (M) Sdn Bhd; Mattel Sdn Bhd; Silverstone Berhad; CMKS (M) Sdn Bhd ; B Braun (M) Sdn Bhd; Conducted training (ITQAN) a value based training:Institut Pentadbiran Awam Brunei; Yayasan Sultan Hj Hassanal Bolkiah, Brunei; Syarikat Air Terengganu Sdn Bhd; Bank Bukopin, Indonesia; Mosque Management Board of Singapore; UTM;and TNB Distribution. And MEDEC ITM trainer for entrepreneurs.
  • Bidang Pengurusan
  • CEO / Principal Madrasah Al Irsyad Al Islamiah, Spore, (2004-2007). Pengurus, Institut Teknologi Tun Abdul Razak, Alor Setar Branch. (Jan,1998 - Dec 2000) Ketua Kursus, Diploma in Planting Industry Management, UiTM Arau, Perlis (1996-1997)

AHMAD SHAFIAI BIN UDA JAAFAR (Pak Utih)

6, Suasana Permai, Bandar Darulaman,

06000 Jitra, Kedah, Malaysia

Hp: 0177272307

Email: pakutih@ymail.com

http://mahligaikasih.multiply.com

Can't Spell Success Without U

Bekas CEO Madrasah Al-Irsyad Al-Islamiah Singapura (2004-2007) yang berpengalaman dalam bidang komunikasi dan kepimpinan suami isteri. Semasa melanjutkan pelajarannya di England, 1994, beliau banyak mengendalikan isu-isu perhubungan suami isteri melalui internet. Selain daripada sumbangan ini, beliau mengendalikan “Roadshow Ceramah Belaian Kasih Keluarga Perantau UK” di beberapa kota utama untuk keluarga-keluarga Melayu. Sekembali ke tanahair, beliau mendapat tauliah daripada JAKIM untuk mengendalikan modul komunikasi dan pengurusan konflik rumah tangga bagi peserta Modul Bersepadu Kursus Pra Perkahwinan Keluarga Islam yang dianjurkan oleh Jabatan Hal Ehwal Agama Islam Perlis. Beliau pernah ke udara setiap pagi isnin dan selasa di dalam segmen “Rangsang Minda” terbitan RTM Pulau Pinang (1996-1998) dan di RTM Johor Bharu (2000) setiap pagi jumaat, sabtu dan ahad membicarakan isu-isu perhubungan suami isteri dan 2005-2006 ke udara setiap petang selasa Cakap Tuan Puan di Radio Warna Singapura. Pernah mengendalikan Bengkel Pendidikan Kesejahteraan Keluarga 1 untuk Pemaju Masyarakat KEMAS yang dijalankan di Nur Lembah Pangsun 2004.