slide1
Download
Skip this Video
Download Presentation
KELOMPOK 5

Loading in 2 Seconds...

play fullscreen
1 / 53

KELOMPOK 5 - PowerPoint PPT Presentation


  • 94 Views
  • Uploaded on

KELOMPOK 5. Frederick Marshall Hade Saputra H Ignatia Chyntia Joan Nababan. Yang akan dibahas : Microstrip (6.6) Transient (6.7) Dispersi (6.8). Microstrip. Sistem transmisi untuk mengirimkan sinyal frekuensi tinggi .

loader
I am the owner, or an agent authorized to act on behalf of the owner, of the copyrighted work described.
capcha
Download Presentation

PowerPoint Slideshow about ' KELOMPOK 5' - mark-randall


An Image/Link below is provided (as is) to download presentation

Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author.While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server.


- - - - - - - - - - - - - - - - - - - - - - - - - - E N D - - - - - - - - - - - - - - - - - - - - - - - - - -
Presentation Transcript
slide1

KELOMPOK 5

Frederick Marshall

Hade Saputra H

IgnatiaChyntia

Joan Nababan

slide2

Yang akandibahas:

  • Microstrip (6.6)
  • Transient (6.7)
  • Dispersi (6.8)
microstrip
Microstrip
  • Sistemtransmisiuntukmengirimkansinyalfrekuensitinggi.
  • Padabagianbawah (substrat) merupakanlembaran metal  garis ground
  • Bagianatasterdapat pita sempitdari metal  signal line
  • Impedansinyamerupakanfungsidarilebarjalursinyal, ketebalandielektrik, danpermitivitasrelatifdielektrik
  • Dapatdigunakandalampembuatan antenna, couplers, filter, sertapembagidaya
  • Keuntungan :
    • Elemenrangkaiandapatdipasangdenganmudahdiatassubstrat
    • Lebihmurahdariteknologipengirimangelombangtradisional
figure 6 30 p 305 cross section of microstrip t line
Figure 6-30 (p. 305)Cross section of microstrip T-line.

Ground plane + signal line + dielectric = microstrip

slide6

Karenasebagiangarismedanadadiudaramengakibatkangelombangtidakterpropagasidlm mode TEM murni.

  • Kecepatanpropagasiupdirumuskandengan

denganasumsidielektriknonmagnetik

  • Konstantafasasepanjanggarisnya:
slide7

Figure 6-31 (p. 305)(a) Typical electric field lines in a cross section of microstrip. (b) Field lines where the air and dielectric have been replaced by a homogeneous medium of effective relative permittivity eff.

  • Panjangdarisesuatugelombangpadasuatufrekuensisepanjang T-line disebutguide wavelength:

denganbesarpermitivitasrelatifefektifεeff :

slide8

Impedansikarakteristikterbagi 2, yaknisaat w/h<1,

dansaat w/h>1

Model persamaandiatastidakdipengaruhinilai t (teballapisan metal) maupunpropagasi yang berdasarkanfrekuensi, namuncukupakurat.

  • Frekuensikerjamaksimummikrostripdipengaruhiolehrugi, dispersi, daneksitasi mode propagasi non-TEM. Untuk w<2h, perhitungan yang biasadigunakanuntukmenghitungfmaxadalah
contoh drill 6 20
ContohDrill 6.20
  • Diketahui: Tebalsubstrat alumina 20 mils, εr = 9,90. Lebarjalursinyal 8.0 mils. (1 mil =25,4μm)
  • Ditanyakan : εeff , up , Zo,danfmax ?
  • Jawab

w/h = 7,5/50 = 0,15<2

    • εeff =
    • Up =
    • Zo =
    • Fmax =
slide10

DibandingkanpencariannilaiZo,sebenarnyalebihseringditemukankasuspencarian w/h yang tepatuntuknilaiZo yang terdapatpadamikrostrip. Untukw/h<2,

untukw/h>2,

Di mana

atenuasi
Atenuasi
  • Atenuasimikrostripdipengaruhirugikonduktor, rugidielektrik, sertarugiradiasi. Karenarugiakibatradiasibisadiperkecildenganmenghindarisuduttajamatauketidaksambungangarismikrostrip, makasebagianbesaratenuasidisebabkanrugidielektrikdaninduktor.

Pendekatansederhanauntukrugikonduktor:

slide12

dimana

(konduktortipis)

Kedalaman kulit:

Pendekatanrugidielektrik:

jalur t planar lain
Jalur-T Planar Lain
  • Meskipunseringdigunakandalamrangkaianfrekuensitinggi, ternyatamikrostripmasihmemilikikekurangan, diantaranya:
    • Dipersif (berbedakompenen, frekuensimengalirdengankecepatanberbeda pula)
    • Untukkomponendiatassubstrat, untukmembuatkontakdengan ground, harusmembuatlubangterisi metal menembuspapan (disebut via)
    • Untukketebalansubstrat yang telahdiketahui, lebar T-line harustetapuntukimpedansikonstan
karena alasan alasan di atas dapat digunakan struktur t line yang lain
Karenaalasan-alasandiatas, dapatdigunakanstruktur T-line yang lain:

Stripline,

Keuntungan:

  • Memilikikeuntungankarenatertutupsempurnaakibatpermukaangroundberadadisisiatasdanbawah.
  • Medan elektrikmenembusdielektrikhomogensehinggatidakmengalamidispersiseparah transistor.

Kelemahan:

  • Sulitsekalimembuatkontak
  • untukkomponendiskrit,
  • misal transistor.

Stripline

slide15

Coplanar Waveguide (CPW),

  • Memilikikeduajalursinyaldanjalur ground padasisisubstrat yang sama, sehinggamenjadistruktur planar termudahuntukmeletakkankomponendiskrit.
  • Impedansidipengaruhirasiolebarjalurtengah (w) denganjarakpemisahgaristengah-ground (s), sehinggapenentuanimpedansijadilebihfleksibel.
  • CBCPW (conduktor-backed coplanar waveguide T-Line), dengan ground plane padasisibelakangselainpadasisidepansaja, sehinggalebihbaikdalamshielding
  • dibanding CPW danpunya
  • karakteristik CPW danmicrostrip.
slide16

TRANSIENTS

  • Adalah suatu perubahan tegangan atau arus yang terjadi yang di dorong di suatu line.
slide17

Salah satucontohdari transients di T-line adalahperambatansinyalsepanjang interconnect di antararangkaiandigital.Informasi yang di bawaadalah 1 dan 0,misalnya 6 V dan 0 V.Perubahan (switching) dari 0 V ke 6 V adalahsuatulangkahperubahanteganganyang merambatsepanjang interconnect.

slide18

Perhatikangambar !

Gambartersebutmemasukkansebuahfungsitegangan di T-line denganmenutup switch di t=0.

  • Tegangan yang dimasukkan di T-line ditentukanoleh voltage divider diantaraimpedansiZsdanimpedansiZo.
slide19

Jaditegangan T-line adalah

  • V0 =Tegangan T-line
  • Vs =Sumbertegangan
  • Zo =Impedansi line
  • ZS =Impedansisumber
slide20

Teganganpadaumumnyabergantungpadalokasi line terhadapwaktusehinggadapat di representasikansebagaiV(z,t).

TeganganawalnyaadalahV(-ℓ,0)=V0

Transit timenyaadalah

Atauwaktuuntuksinyalmelewatipanjang line l terhadapkecepatanmerambat Up.

slide21

PadaakhirwaktutL,

Sebagiansinyalterpantul.

KoefisienpantulnyarL

Padaawal 2tL ,koefisienrS

contoh soal
Contohsoal
  • Misalkanrangkaian

diberinilaimasing-

masingsepertigambar.

Zs=25 ohm,panjang T-

line=6 cm,Zo=75 ohm,

Zl=125 ohm.Up = 0,1c.

Vs = 4 V

Tentukan:

V0!

rLdanrs !

Transmit time!

Tegangan di setiap line pada

Waktu yang sangat lama!

slide25

After a long enough time, the reflection will settle down and the voltage at every point along of the line will equal:

contoh soal drill 6 23
ContohsoalDrill 6.23
  • Misalkanrangkaian

diberinilaimasing-

masingsepertigambar.

Zs=125 ohm,panjang T-

line=6 cm,Zo=75 ohm,

Zl=25 ohm.Up = 0,1c.

Vs = 4 V

Tentukan:

V0!

rLdanrs !

Transmit time!

Tegangan di setiap line pada

Waktu yang sangat lama!

slide28

Figure 6-34a (p. 314)(a) T-line circuit and bounce diagram for a voltage step change.

1,5 V

1,5 x (-1/2) V

1,5 x (-1/2) x (1/4) V

respons berdenyut
Responsberdenyut
  • Pulsaberdenyutdapat di gambarkanseperirangkaian T-line denganmenambahkansebuah switch dekat supply saat t=T (gambar b)
slide31

Padagambar a ,tegangansaat t=o sampai t=T adalahVo,namunsaat t>T,nilai Vo adalah –Vo karenaadanya short circuit dekatteganganmengakibatkanaraharusdaritegangansumberberbalikarah.

slide33

Sebagaicontohkitamengambilcontohsoal T-line tadi ,namunpadasaat 3 ns,tegangan V0menjadi –V0.Berikut gambarnya.

aplikasi schottky diode termination
Aplikasi:Schottky-Diode Termination.
  • Sinyalrefleksidapatdieleminasidengan terminating end of the line dalambeban.Tapi, bebanimpedansidalamrangkaian digital mungkintidakdiketahui,ataubergantungpada logic state. Bahkanjikabebanimpedansidiketahui,pemakaandaya yang tidakdiinginkanakanterjadi.
  • Schottky-Diode Termination:

- meningkatkanperformafrekuensitinggidalam interconnect digital.

- forward bias drop yang sangatkecil,relatifcepat, danmudah di integrasikandengan digital logic.

slide35

Perhatikangambar!

  • Dari gambardiodaschottkydipasangdiantara transmission line danbeban ZL.
  • Tujuandipasangnyadioda (D1) tersebut agar jikabeban ZL = ∞ (open circuit) makapulsarefleksiakantetapmempunyainilaiVcc.
  • Begitujugajikabeban ZL = 0, makapulsarefleksinyatetapmenjadiVcc,jikatidakadadiodamakapulsarefleksiakanmenjadinol (short circuit)
slide36

D3 1N5818

A low voltage high current rectifier diode, useful in applications where a low voltage drop is required.

transient disaat beban reaktif
Transient disaatbebanreaktif

Berdasarkangambarbebaninduktifdiatas, nilaitegangan total adalah

dimana

U(τ) =

Figure 6-42 (p. 322)

slide38

merupakanfungsiwaktu, jaditidakterlaluberpengaruh. Tapi, dalamanalisis transient, kitaharusmempertimbangkanhubunganinduktansi, yaitu :

Dari pertemuansebelumnya :

Jadi :

slide39

Dari persamaan-persamaandiatasdidapatkan :

Denganmenggunakan first order analisisdidapat :

Kita dapatmenilai VL(t)sebagaimanaditunjukkanpadaGambardibawah.

slide40

The 6-cm-long, 75- up = 0.1c T-line is terminated in a 20-nH inductor.The voltage at the load end

slide41

Akhirnya, voltasesaatrefleksiadalah

  • Kita bisamenilaiteganganpadasumberterakhir, Vs(t), denganmenyadaribahwa τ = t – 2tℓ. Kita dapatkan
  • Hal inidiplotpadagambarberikut.
  • Induktorkelihatanseperti open circuit setelahwaktunyatelahmemenuhi.
slide42

The 6-cm-long, 75- up = 0.1c T-line is terminated in a 20-nH inductor.The voltage at the source end

slide43

Pada figure 6.44, teganganpadabebanakhiradalah

dimana τ = t - tℓ. Setelahkapasitorterisi, makaakan open circuit.

slide44
Figure 6-44 (p. 324) The T-line of Figure 6.42 is now terminated in a capacitor. Plot shows the voltage at the load end.
time domain reflectometry tdr
Time domain reflectometry (TDR)

Merupakanmetode yang digunakanuntukmenemukanlokasidiskontinupadapentransmisian

Tiap plot pada TDR mendeskripsikankarakteristikbeban yang ada (gambar 6.45)

Lokasidiskontinudapatdiketahuidenganrumus :

Figure 6-45 (p. 325)TDR plots for Z° T-line with various terminations. A 1-V incident step change in voltage is assumed.

contoh
Contoh :

Analisislah TDR respon yang ditampilkanpadagambar 6.46a untuk t-line sebesar50 Ωdengan up=0,6c

Gambar 6.46a :

Makajarakdiskontinunya :

slide47

Dari grafiktersebutdapatdihitungkoefisienpantulnya, yaitu :

Dari TDR plot (6.46a) diketahuibahwarangkaiantersebutresistifdengan RL>Zo . RL dapatdihitungdengan :

sehingga

dispersi
DISPERSI
  • Sinyalpulsajikadiuraikandenganderet Fourier, iaterdiridarifrekuensi sinusoidal.
  • Komponenfrekuensi yang berbedaakanmenghasilkanpulsa, olehkarenaitu, sehinggajikapulsaberjalandengankecepatan yang berbedamakapulsaakanmengalamipelebaran = dispersi.
contoh penguraian
Contohpenguraian
  • Denganderet Fourier :
  • Yang mana a0 adalah
  • rata-rata magnitudo
  • gelombang, serta an
  • danbn adalah koefisienderet Fourier.
slide51

ω0 adalah frekuensi angular dengan

  • Untukkeadaankhusus, yaknifungsigenap, kitadapatmensimpulkan
slide52

a0 adalah 1.2 V, sedangkan an

  • Grafikdisamping adalah

representasideret Fourier

yang diplotuntukpulsa

dengan N = 10, N = 100,

dan N=1000 menurut

slide53

Sinyalmerambatsecaraharmoniksepanjang T-line menurtpersamaan

  • Saatωn = nω0
  • Saatεrmerupakanfungsidarifrekuensi
ad