1 / 53

KELOMPOK 5 - PowerPoint PPT Presentation

  • Uploaded on

KELOMPOK 5. Frederick Marshall Hade Saputra H Ignatia Chyntia Joan Nababan. Yang akan dibahas : Microstrip (6.6) Transient (6.7) Dispersi (6.8). Microstrip. Sistem transmisi untuk mengirimkan sinyal frekuensi tinggi .

I am the owner, or an agent authorized to act on behalf of the owner, of the copyrighted work described.
Download Presentation

PowerPoint Slideshow about ' KELOMPOK 5' - mark-randall

An Image/Link below is provided (as is) to download presentation

Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author.While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server.

- - - - - - - - - - - - - - - - - - - - - - - - - - E N D - - - - - - - - - - - - - - - - - - - - - - - - - -
Presentation Transcript


Frederick Marshall

Hade Saputra H


Joan Nababan

  • Yang akandibahas:

  • Microstrip (6.6)

  • Transient (6.7)

  • Dispersi (6.8)


  • Sistemtransmisiuntukmengirimkansinyalfrekuensitinggi.

  • Padabagianbawah (substrat) merupakanlembaran metal  garis ground

  • Bagianatasterdapat pita sempitdari metal  signal line

  • Impedansinyamerupakanfungsidarilebarjalursinyal, ketebalandielektrik, danpermitivitasrelatifdielektrik

  • Dapatdigunakandalampembuatan antenna, couplers, filter, sertapembagidaya

  • Keuntungan :

    • Elemenrangkaiandapatdipasangdenganmudahdiatassubstrat

    • Lebihmurahdariteknologipengirimangelombangtradisional

Figure 6 30 p 305 cross section of microstrip t line
Figure 6-30 (p. 305)Cross section of microstrip T-line.

Ground plane + signal line + dielectric = microstrip


  • Karenasebagiangarismedanadadiudaramengakibatkangelombangtidakterpropagasidlm mode TEM murni.

  • Kecepatanpropagasiupdirumuskandengan


  • Konstantafasasepanjanggarisnya:

Figure 6-31 (p. 305)(a) Typical electric field lines in a cross section of microstrip. (b) Field lines where the air and dielectric have been replaced by a homogeneous medium of effective relative permittivity eff.

  • Panjangdarisesuatugelombangpadasuatufrekuensisepanjang T-line disebutguide wavelength:

    denganbesarpermitivitasrelatifefektifεeff :

  • Impedansikarakteristikterbagi 2, yaknisaat w/h<1,

    dansaat w/h>1

    Model persamaandiatastidakdipengaruhinilai t (teballapisan metal) maupunpropagasi yang berdasarkanfrekuensi, namuncukupakurat.

  • Frekuensikerjamaksimummikrostripdipengaruhiolehrugi, dispersi, daneksitasi mode propagasi non-TEM. Untuk w<2h, perhitungan yang biasadigunakanuntukmenghitungfmaxadalah

Contoh drill 6 20
ContohDrill 6.20

  • Diketahui: Tebalsubstrat alumina 20 mils, εr = 9,90. Lebarjalursinyal 8.0 mils. (1 mil =25,4μm)

  • Ditanyakan : εeff , up , Zo,danfmax ?

  • Jawab

    w/h = 7,5/50 = 0,15<2

    • εeff =

    • Up =

    • Zo =

    • Fmax =

  • DibandingkanpencariannilaiZo,sebenarnyalebihseringditemukankasuspencarian w/h yang tepatuntuknilaiZo yang terdapatpadamikrostrip. Untukw/h<2,


    Di mana


  • Atenuasimikrostripdipengaruhirugikonduktor, rugidielektrik, sertarugiradiasi. Karenarugiakibatradiasibisadiperkecildenganmenghindarisuduttajamatauketidaksambungangarismikrostrip, makasebagianbesaratenuasidisebabkanrugidielektrikdaninduktor.




Kedalaman kulit:


Jalur t planar lain
Jalur-T Planar Lain

  • Meskipunseringdigunakandalamrangkaianfrekuensitinggi, ternyatamikrostripmasihmemilikikekurangan, diantaranya:

    • Dipersif (berbedakompenen, frekuensimengalirdengankecepatanberbeda pula)

    • Untukkomponendiatassubstrat, untukmembuatkontakdengan ground, harusmembuatlubangterisi metal menembuspapan (disebut via)

    • Untukketebalansubstrat yang telahdiketahui, lebar T-line harustetapuntukimpedansikonstan

Karena alasan alasan di atas dapat digunakan struktur t line yang lain
Karenaalasan-alasandiatas, dapatdigunakanstruktur T-line yang lain:



  • Memilikikeuntungankarenatertutupsempurnaakibatpermukaangroundberadadisisiatasdanbawah.

  • Medan elektrikmenembusdielektrikhomogensehinggatidakmengalamidispersiseparah transistor.


  • Sulitsekalimembuatkontak

  • untukkomponendiskrit,

  • misal transistor.


  • Coplanar Waveguide (CPW),

  • Memilikikeduajalursinyaldanjalur ground padasisisubstrat yang sama, sehinggamenjadistruktur planar termudahuntukmeletakkankomponendiskrit.

  • Impedansidipengaruhirasiolebarjalurtengah (w) denganjarakpemisahgaristengah-ground (s), sehinggapenentuanimpedansijadilebihfleksibel.

  • CBCPW (conduktor-backed coplanar waveguide T-Line), dengan ground plane padasisibelakangselainpadasisidepansaja, sehinggalebihbaikdalamshielding

  • dibanding CPW danpunya

  • karakteristik CPW danmicrostrip.


  • Adalah suatu perubahan tegangan atau arus yang terjadi yang di dorong di suatu line.

  • Salah satucontohdari transients di T-line adalahperambatansinyalsepanjang interconnect di antararangkaiandigital.Informasi yang di bawaadalah 1 dan 0,misalnya 6 V dan 0 V.Perubahan (switching) dari 0 V ke 6 V adalahsuatulangkahperubahanteganganyang merambatsepanjang interconnect.

  • Perhatikangambar !

    Gambartersebutmemasukkansebuahfungsitegangan di T-line denganmenutup switch di t=0.

  • Tegangan yang dimasukkan di T-line ditentukanoleh voltage divider diantaraimpedansiZsdanimpedansiZo.

  • Jaditegangan T-line adalah

  • V0 =Tegangan T-line

  • Vs =Sumbertegangan

  • Zo =Impedansi line

  • ZS =Impedansisumber

Teganganpadaumumnyabergantungpadalokasi line terhadapwaktusehinggadapat di representasikansebagaiV(z,t).


Transit timenyaadalah

Atauwaktuuntuksinyalmelewatipanjang line l terhadapkecepatanmerambat Up.




Padaawal 2tL ,koefisienrS

  • Sehinggakitadapatmenentukanteganganawal T-line saatwaktu 0 sampai 2tL

Contoh soal

  • Misalkanrangkaian



    Zs=25 ohm,panjang T-

    line=6 cm,Zo=75 ohm,

    Zl=125 ohm.Up = 0,1c.

    Vs = 4 V



    rLdanrs !

    Transmit time!

    Tegangan di setiap line pada

    Waktu yang sangat lama!

Figure 6-34a (p. 314)(a) T-line circuit and bounce diagram for a voltage step change.

After a long enough time, the reflection will settle down and the voltage at every point along of the line will equal:

  • Berikut and the voltage at every point along of the line will equal: gambartegangan di tengah line sampat t=8ns

Contoh soal drill 6 23
Contoh and the voltage at every point along of the line will equal: soalDrill 6.23

  • Misalkanrangkaian



    Zs=125 ohm,panjang T-

    line=6 cm,Zo=75 ohm,

    Zl=25 ohm.Up = 0,1c.

    Vs = 4 V



    rLdanrs !

    Transmit time!

    Tegangan di setiap line pada

    Waktu yang sangat lama!

Figure 6-34a (p. 314) and the voltage at every point along of the line will equal: (a) T-line circuit and bounce diagram for a voltage step change.

1,5 V

1,5 x (-1/2) V

1,5 x (-1/2) x (1/4) V

Plot and the voltage at every point along of the line will equal: teganganpada source end di Drill 6.23

Respons berdenyut
Respons and the voltage at every point along of the line will equal: berdenyut

  • Pulsaberdenyutdapat di gambarkanseperirangkaian T-line denganmenambahkansebuah switch dekat supply saat t=T (gambar b)

  • Pada and the voltage at every point along of the line will equal: gambar a ,tegangansaat t=o sampai t=T adalahVo,namunsaat t>T,nilai Vo adalah –Vo karenaadanya short circuit dekatteganganmengakibatkanaraharusdaritegangansumberberbalikarah.

  • Berikut and the voltage at every point along of the line will equal: diagram bounce untuk input pulsa di tengah line.

  • Sebagai and the voltage at every point along of the line will equal: contohkitamengambilcontohsoal T-line tadi ,namunpadasaat 3 ns,tegangan V0menjadi –V0.Berikut gambarnya.

Aplikasi schottky diode termination
Aplikasi:Schottky and the voltage at every point along of the line will equal: -Diode Termination.

  • Sinyalrefleksidapatdieleminasidengan terminating end of the line dalambeban.Tapi, bebanimpedansidalamrangkaian digital mungkintidakdiketahui,ataubergantungpada logic state. Bahkanjikabebanimpedansidiketahui,pemakaandaya yang tidakdiinginkanakanterjadi.

  • Schottky-Diode Termination:

    - meningkatkanperformafrekuensitinggidalam interconnect digital.

    - forward bias drop yang sangatkecil,relatifcepat, danmudah di integrasikandengan digital logic.

  • Perhatikan and the voltage at every point along of the line will equal: gambar!

  • Dari gambardiodaschottkydipasangdiantara transmission line danbeban ZL.

  • Tujuandipasangnyadioda (D1) tersebut agar jikabeban ZL = ∞ (open circuit) makapulsarefleksiakantetapmempunyainilaiVcc.

  • Begitujugajikabeban ZL = 0, makapulsarefleksinyatetapmenjadiVcc,jikatidakadadiodamakapulsarefleksiakanmenjadinol (short circuit)

D3 1N5818 and the voltage at every point along of the line will equal:

A low voltage high current rectifier diode, useful in applications where a low voltage drop is required.

Transient disaat beban reaktif
Transient and the voltage at every point along of the line will equal: disaatbebanreaktif

Berdasarkangambarbebaninduktifdiatas, nilaitegangan total adalah


U(τ) =

Figure 6-42 (p. 322)

merupakan and the voltage at every point along of the line will equal: fungsiwaktu, jaditidakterlaluberpengaruh. Tapi, dalamanalisis transient, kitaharusmempertimbangkanhubunganinduktansi, yaitu :

Dari pertemuansebelumnya :

Jadi :

Dari and the voltage at every point along of the line will equal: persamaan-persamaandiatasdidapatkan :

Denganmenggunakan first order analisisdidapat :

Kita dapatmenilai VL(t)sebagaimanaditunjukkanpadaGambardibawah.

The 6-cm-long, 75- and the voltage at every point along of the line will equal:  up = 0.1c T-line is terminated in a 20-nH inductor.The voltage at the load end

  • Akhirnya and the voltage at every point along of the line will equal: , voltasesaatrefleksiadalah

  • Kita bisamenilaiteganganpadasumberterakhir, Vs(t), denganmenyadaribahwa τ = t – 2tℓ. Kita dapatkan

  • Hal inidiplotpadagambarberikut.

  • Induktorkelihatanseperti open circuit setelahwaktunyatelahmemenuhi.

The 6-cm-long, 75- and the voltage at every point along of the line will equal:  up = 0.1c T-line is terminated in a 20-nH inductor.The voltage at the source end

  • Pada and the voltage at every point along of the line will equal: figure 6.44, teganganpadabebanakhiradalah

    dimana τ = t - tℓ. Setelahkapasitorterisi, makaakan open circuit.

Figure 6-44 (p. 324) and the voltage at every point along of the line will equal: The T-line of Figure 6.42 is now terminated in a capacitor. Plot shows the voltage at the load end.

Time domain reflectometry tdr
Time domain and the voltage at every point along of the line will equal: reflectometry (TDR)

Merupakanmetode yang digunakanuntukmenemukanlokasidiskontinupadapentransmisian

Tiap plot pada TDR mendeskripsikankarakteristikbeban yang ada (gambar 6.45)

Lokasidiskontinudapatdiketahuidenganrumus :

Figure 6-45 (p. 325)TDR plots for Z° T-line with various terminations. A 1-V incident step change in voltage is assumed.

Contoh and the voltage at every point along of the line will equal: :

Analisislah TDR respon yang ditampilkanpadagambar 6.46a untuk t-line sebesar50 Ωdengan up=0,6c

Gambar 6.46a :

Makajarakdiskontinunya :

Dari and the voltage at every point along of the line will equal: grafiktersebutdapatdihitungkoefisienpantulnya, yaitu :

Dari TDR plot (6.46a) diketahuibahwarangkaiantersebutresistifdengan RL>Zo . RL dapatdihitungdengan :


i and the voltage at every point along of the line will equal:

DISPERSI and the voltage at every point along of the line will equal:

  • Sinyalpulsajikadiuraikandenganderet Fourier, iaterdiridarifrekuensi sinusoidal.

  • Komponenfrekuensi yang berbedaakanmenghasilkanpulsa, olehkarenaitu, sehinggajikapulsaberjalandengankecepatan yang berbedamakapulsaakanmengalamipelebaran = dispersi.

Contoh penguraian
Contoh and the voltage at every point along of the line will equal: penguraian

  • Denganderet Fourier :

  • Yang mana a0 adalah

  • rata-rata magnitudo

  • gelombang, serta an

  • danbn adalah koefisienderet Fourier.

  • ω and the voltage at every point along of the line will equal: 0 adalah frekuensi angular dengan

  • Untukkeadaankhusus, yaknifungsigenap, kitadapatmensimpulkan

  • a and the voltage at every point along of the line will equal: 0 adalah 1.2 V, sedangkan an

  • Grafikdisamping adalah

    representasideret Fourier

    yang diplotuntukpulsa

    dengan N = 10, N = 100,

    dan N=1000 menurut

  • Sinyal and the voltage at every point along of the line will equal: merambatsecaraharmoniksepanjang T-line menurtpersamaan

  • Saatωn = nω0

  • Saatεrmerupakanfungsidarifrekuensi
