KELOMPOK 5
This presentation is the property of its rightful owner.
Sponsored Links
1 / 53

KELOMPOK 5 PowerPoint PPT Presentation


  • 57 Views
  • Uploaded on
  • Presentation posted in: General

KELOMPOK 5. Frederick Marshall Hade Saputra H Ignatia Chyntia Joan Nababan. Yang akan dibahas : Microstrip (6.6) Transient (6.7) Dispersi (6.8). Microstrip. Sistem transmisi untuk mengirimkan sinyal frekuensi tinggi .

Download Presentation

KELOMPOK 5

An Image/Link below is provided (as is) to download presentation

Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author.While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server.


- - - - - - - - - - - - - - - - - - - - - - - - - - E N D - - - - - - - - - - - - - - - - - - - - - - - - - -

Presentation Transcript


Kelompok 5

KELOMPOK 5

Frederick Marshall

Hade Saputra H

IgnatiaChyntia

Joan Nababan


Kelompok 5

  • Yang akandibahas:

  • Microstrip (6.6)

  • Transient (6.7)

  • Dispersi (6.8)


Microstrip

Microstrip

  • Sistemtransmisiuntukmengirimkansinyalfrekuensitinggi.

  • Padabagianbawah (substrat) merupakanlembaran metal  garis ground

  • Bagianatasterdapat pita sempitdari metal  signal line

  • Impedansinyamerupakanfungsidarilebarjalursinyal, ketebalandielektrik, danpermitivitasrelatifdielektrik

  • Dapatdigunakandalampembuatan antenna, couplers, filter, sertapembagidaya

  • Keuntungan :

    • Elemenrangkaiandapatdipasangdenganmudahdiatassubstrat

    • Lebihmurahdariteknologipengirimangelombangtradisional


Figure 6 30 p 305 cross section of microstrip t line

Figure 6-30 (p. 305)Cross section of microstrip T-line.

Ground plane + signal line + dielectric = microstrip


Kelompok 5

Contohmicrostrip


Kelompok 5

  • Karenasebagiangarismedanadadiudaramengakibatkangelombangtidakterpropagasidlm mode TEM murni.

  • Kecepatanpropagasiupdirumuskandengan

    denganasumsidielektriknonmagnetik

  • Konstantafasasepanjanggarisnya:


Kelompok 5

Figure 6-31 (p. 305)(a) Typical electric field lines in a cross section of microstrip. (b) Field lines where the air and dielectric have been replaced by a homogeneous medium of effective relative permittivity eff.

  • Panjangdarisesuatugelombangpadasuatufrekuensisepanjang T-line disebutguide wavelength:

    denganbesarpermitivitasrelatifefektifεeff :


Kelompok 5

  • Impedansikarakteristikterbagi 2, yaknisaat w/h<1,

    dansaat w/h>1

    Model persamaandiatastidakdipengaruhinilai t (teballapisan metal) maupunpropagasi yang berdasarkanfrekuensi, namuncukupakurat.

  • Frekuensikerjamaksimummikrostripdipengaruhiolehrugi, dispersi, daneksitasi mode propagasi non-TEM. Untuk w<2h, perhitungan yang biasadigunakanuntukmenghitungfmaxadalah


Contoh drill 6 20

ContohDrill 6.20

  • Diketahui: Tebalsubstrat alumina 20 mils, εr = 9,90. Lebarjalursinyal 8.0 mils. (1 mil =25,4μm)

  • Ditanyakan : εeff , up , Zo,danfmax ?

  • Jawab

    w/h = 7,5/50 = 0,15<2

    • εeff =

    • Up =

    • Zo =

    • Fmax =


Kelompok 5

  • DibandingkanpencariannilaiZo,sebenarnyalebihseringditemukankasuspencarian w/h yang tepatuntuknilaiZo yang terdapatpadamikrostrip. Untukw/h<2,

    untukw/h>2,

    Di mana


Atenuasi

Atenuasi

  • Atenuasimikrostripdipengaruhirugikonduktor, rugidielektrik, sertarugiradiasi. Karenarugiakibatradiasibisadiperkecildenganmenghindarisuduttajamatauketidaksambungangarismikrostrip, makasebagianbesaratenuasidisebabkanrugidielektrikdaninduktor.

Pendekatansederhanauntukrugikonduktor:


Kelompok 5

dimana

(konduktortipis)

Kedalaman kulit:

Pendekatanrugidielektrik:


Jalur t planar lain

Jalur-T Planar Lain

  • Meskipunseringdigunakandalamrangkaianfrekuensitinggi, ternyatamikrostripmasihmemilikikekurangan, diantaranya:

    • Dipersif (berbedakompenen, frekuensimengalirdengankecepatanberbeda pula)

    • Untukkomponendiatassubstrat, untukmembuatkontakdengan ground, harusmembuatlubangterisi metal menembuspapan (disebut via)

    • Untukketebalansubstrat yang telahdiketahui, lebar T-line harustetapuntukimpedansikonstan


Karena alasan alasan di atas dapat digunakan struktur t line yang lain

Karenaalasan-alasandiatas, dapatdigunakanstruktur T-line yang lain:

Stripline,

Keuntungan:

  • Memilikikeuntungankarenatertutupsempurnaakibatpermukaangroundberadadisisiatasdanbawah.

  • Medan elektrikmenembusdielektrikhomogensehinggatidakmengalamidispersiseparah transistor.

    Kelemahan:

  • Sulitsekalimembuatkontak

  • untukkomponendiskrit,

  • misal transistor.

Stripline


Kelompok 5

  • Coplanar Waveguide (CPW),

  • Memilikikeduajalursinyaldanjalur ground padasisisubstrat yang sama, sehinggamenjadistruktur planar termudahuntukmeletakkankomponendiskrit.

  • Impedansidipengaruhirasiolebarjalurtengah (w) denganjarakpemisahgaristengah-ground (s), sehinggapenentuanimpedansijadilebihfleksibel.

  • CBCPW (conduktor-backed coplanar waveguide T-Line), dengan ground plane padasisibelakangselainpadasisidepansaja, sehinggalebihbaikdalamshielding

  • dibanding CPW danpunya

  • karakteristik CPW danmicrostrip.


Kelompok 5

TRANSIENTS

  • Adalah suatu perubahan tegangan atau arus yang terjadi yang di dorong di suatu line.


Kelompok 5

  • Salah satucontohdari transients di T-line adalahperambatansinyalsepanjang interconnect di antararangkaiandigital.Informasi yang di bawaadalah 1 dan 0,misalnya 6 V dan 0 V.Perubahan (switching) dari 0 V ke 6 V adalahsuatulangkahperubahanteganganyang merambatsepanjang interconnect.


Kelompok 5

  • Perhatikangambar !

    Gambartersebutmemasukkansebuahfungsitegangan di T-line denganmenutup switch di t=0.

  • Tegangan yang dimasukkan di T-line ditentukanoleh voltage divider diantaraimpedansiZsdanimpedansiZo.


Kelompok 5

  • Jaditegangan T-line adalah

  • V0 =Tegangan T-line

  • Vs =Sumbertegangan

  • Zo =Impedansi line

  • ZS =Impedansisumber


Kelompok 5

Teganganpadaumumnyabergantungpadalokasi line terhadapwaktusehinggadapat di representasikansebagaiV(z,t).

TeganganawalnyaadalahV(-ℓ,0)=V0

Transit timenyaadalah

Atauwaktuuntuksinyalmelewatipanjang line l terhadapkecepatanmerambat Up.


Kelompok 5

PadaakhirwaktutL,

Sebagiansinyalterpantul.

KoefisienpantulnyarL

Padaawal 2tL ,koefisienrS


Kelompok 5

  • Sehinggakitadapatmenentukanteganganawal T-line saatwaktu 0 sampai 2tL


Contoh soal

Contohsoal

  • Misalkanrangkaian

    diberinilaimasing-

    masingsepertigambar.

    Zs=25 ohm,panjang T-

    line=6 cm,Zo=75 ohm,

    Zl=125 ohm.Up = 0,1c.

    Vs = 4 V

    Tentukan:

    V0!

    rLdanrs !

    Transmit time!

    Tegangan di setiap line pada

    Waktu yang sangat lama!


Kelompok 5

Figure 6-34a (p. 314)(a) T-line circuit and bounce diagram for a voltage step change.


Kelompok 5

After a long enough time, the reflection will settle down and the voltage at every point along of the line will equal:


Kelompok 5

  • Berikutgambartegangan di tengah line sampat t=8ns


Contoh soal drill 6 23

ContohsoalDrill 6.23

  • Misalkanrangkaian

    diberinilaimasing-

    masingsepertigambar.

    Zs=125 ohm,panjang T-

    line=6 cm,Zo=75 ohm,

    Zl=25 ohm.Up = 0,1c.

    Vs = 4 V

    Tentukan:

    V0!

    rLdanrs !

    Transmit time!

    Tegangan di setiap line pada

    Waktu yang sangat lama!


Kelompok 5

Figure 6-34a (p. 314)(a) T-line circuit and bounce diagram for a voltage step change.

1,5 V

1,5 x (-1/2) V

1,5 x (-1/2) x (1/4) V


Kelompok 5

Plot teganganpada source end di Drill 6.23


Respons berdenyut

Responsberdenyut

  • Pulsaberdenyutdapat di gambarkanseperirangkaian T-line denganmenambahkansebuah switch dekat supply saat t=T (gambar b)


Kelompok 5

  • Padagambar a ,tegangansaat t=o sampai t=T adalahVo,namunsaat t>T,nilai Vo adalah –Vo karenaadanya short circuit dekatteganganmengakibatkanaraharusdaritegangansumberberbalikarah.


Kelompok 5

  • Berikut diagram bounce untuk input pulsa di tengah line.


Kelompok 5

  • Sebagaicontohkitamengambilcontohsoal T-line tadi ,namunpadasaat 3 ns,tegangan V0menjadi –V0.Berikut gambarnya.


Aplikasi schottky diode termination

Aplikasi:Schottky-Diode Termination.

  • Sinyalrefleksidapatdieleminasidengan terminating end of the line dalambeban.Tapi, bebanimpedansidalamrangkaian digital mungkintidakdiketahui,ataubergantungpada logic state. Bahkanjikabebanimpedansidiketahui,pemakaandaya yang tidakdiinginkanakanterjadi.

  • Schottky-Diode Termination:

    - meningkatkanperformafrekuensitinggidalam interconnect digital.

    - forward bias drop yang sangatkecil,relatifcepat, danmudah di integrasikandengan digital logic.


Kelompok 5

  • Perhatikangambar!

  • Dari gambardiodaschottkydipasangdiantara transmission line danbeban ZL.

  • Tujuandipasangnyadioda (D1) tersebut agar jikabeban ZL = ∞ (open circuit) makapulsarefleksiakantetapmempunyainilaiVcc.

  • Begitujugajikabeban ZL = 0, makapulsarefleksinyatetapmenjadiVcc,jikatidakadadiodamakapulsarefleksiakanmenjadinol (short circuit)


Kelompok 5

D3 1N5818

A low voltage high current rectifier diode, useful in applications where a low voltage drop is required.


Transient disaat beban reaktif

Transient disaatbebanreaktif

Berdasarkangambarbebaninduktifdiatas, nilaitegangan total adalah

dimana

U(τ) =

Figure 6-42 (p. 322)


Kelompok 5

merupakanfungsiwaktu, jaditidakterlaluberpengaruh. Tapi, dalamanalisis transient, kitaharusmempertimbangkanhubunganinduktansi, yaitu :

Dari pertemuansebelumnya :

Jadi :


Kelompok 5

Dari persamaan-persamaandiatasdidapatkan :

Denganmenggunakan first order analisisdidapat :

Kita dapatmenilai VL(t)sebagaimanaditunjukkanpadaGambardibawah.


Kelompok 5

The 6-cm-long, 75- up = 0.1c T-line is terminated in a 20-nH inductor.The voltage at the load end


Kelompok 5

  • Akhirnya, voltasesaatrefleksiadalah

  • Kita bisamenilaiteganganpadasumberterakhir, Vs(t), denganmenyadaribahwa τ = t – 2tℓ. Kita dapatkan

  • Hal inidiplotpadagambarberikut.

  • Induktorkelihatanseperti open circuit setelahwaktunyatelahmemenuhi.


Kelompok 5

The 6-cm-long, 75- up = 0.1c T-line is terminated in a 20-nH inductor.The voltage at the source end


Kelompok 5

  • Pada figure 6.44, teganganpadabebanakhiradalah

    dimana τ = t - tℓ. Setelahkapasitorterisi, makaakan open circuit.


Kelompok 5

Figure 6-44 (p. 324) The T-line of Figure 6.42 is now terminated in a capacitor. Plot shows the voltage at the load end.


Time domain reflectometry tdr

Time domain reflectometry (TDR)

Merupakanmetode yang digunakanuntukmenemukanlokasidiskontinupadapentransmisian

Tiap plot pada TDR mendeskripsikankarakteristikbeban yang ada (gambar 6.45)

Lokasidiskontinudapatdiketahuidenganrumus :

Figure 6-45 (p. 325)TDR plots for Z° T-line with various terminations. A 1-V incident step change in voltage is assumed.


Contoh

Contoh :

Analisislah TDR respon yang ditampilkanpadagambar 6.46a untuk t-line sebesar50 Ωdengan up=0,6c

Gambar 6.46a :

Makajarakdiskontinunya :


Kelompok 5

Dari grafiktersebutdapatdihitungkoefisienpantulnya, yaitu :

Dari TDR plot (6.46a) diketahuibahwarangkaiantersebutresistifdengan RL>Zo . RL dapatdihitungdengan :

sehingga


Kelompok 5

i


Dispersi

DISPERSI

  • Sinyalpulsajikadiuraikandenganderet Fourier, iaterdiridarifrekuensi sinusoidal.

  • Komponenfrekuensi yang berbedaakanmenghasilkanpulsa, olehkarenaitu, sehinggajikapulsaberjalandengankecepatan yang berbedamakapulsaakanmengalamipelebaran = dispersi.


Contoh penguraian

Contohpenguraian

  • Denganderet Fourier :

  • Yang mana a0 adalah

  • rata-rata magnitudo

  • gelombang, serta an

  • danbn adalah koefisienderet Fourier.


Kelompok 5

  • ω0 adalah frekuensi angular dengan

  • Untukkeadaankhusus, yaknifungsigenap, kitadapatmensimpulkan


Kelompok 5

  • a0 adalah 1.2 V, sedangkan an

  • Grafikdisamping adalah

    representasideret Fourier

    yang diplotuntukpulsa

    dengan N = 10, N = 100,

    dan N=1000 menurut


Kelompok 5

  • Sinyalmerambatsecaraharmoniksepanjang T-line menurtpersamaan

  • Saatωn = nω0

  • Saatεrmerupakanfungsidarifrekuensi


  • Login