pengantar akuntansi sektor publik n.
Skip this Video
Loading SlideShow in 5 Seconds..
Pengantar Akuntansi Sektor Publik PowerPoint Presentation
Download Presentation
Pengantar Akuntansi Sektor Publik

Loading in 2 Seconds...

play fullscreen
1 / 68

Pengantar Akuntansi Sektor Publik - PowerPoint PPT Presentation

  • Uploaded on

Pengantar Akuntansi Sektor Publik. D3 Unsri , Abdul Rohman SE, Msi. Sejarah Singkat ASP.

I am the owner, or an agent authorized to act on behalf of the owner, of the copyrighted work described.
Download Presentation

Pengantar Akuntansi Sektor Publik

An Image/Link below is provided (as is) to download presentation

Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author.While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server.

- - - - - - - - - - - - - - - - - - - - - - - - - - E N D - - - - - - - - - - - - - - - - - - - - - - - - - -
    Presentation Transcript
    1. PengantarAkuntansiSektorPublik D3 Unsri, Abdul Rohman SE, Msi

    2. SejarahSingkat ASP • Sejarahorganisasisektorpubliksebenarnyasudahadasejakribuantahun yang lalu. Dalambukunya, Vernon Kam (1989) menjelaskanbahwapraktikakuntansisektorpubliksebenarnyatelahadasejakribuantahunsebelummasehi. • Kemunculannyalebihdipengaruhipadainteraksi yang terjadipadamasyarakatdankekuatansosialdidalammasyarakat. • Kekuatansosialmasyarakat, yang umumnyaberbentukpemerintahan – organisasisektorpublikini, dapatdiklasifikasikandalam: • Semangatkapitalisasi (Capitalistic Spirit). • Peristiwapolitikdanekonomi (Economic and Politic Event). • Inovasiteknologi (Technology Inovation).

    3. Sejarah Organisasi Sektor Publik • Mesir • Organisasikementriandidirikanuntukmengadministrasikanlaporanuntukperdanamenteri • Menterimembuatlaporanbulananterkaitdenganhasilpemungutanpajak. • Distrikmenyimpancatatankekayaansebagaidasarpemungutanpajak. • Babilonia • Praktikpencatatantelahdilakukandalamberbagaikegiatanuntukmenghasilkanpendapatandanproduksi

    4. Sejarah Organisasi Sektor Publik • Yunani • Pemerintahmembagisecaraadilsumberpendapatan yang diterimaolehPhartenon • Telahmengembangkanberbagaimetodepencatatanbarang yang berharga. • Praktikakuntansidigunakanuntukmendukungmekanismepajak • Pencatatantransaksidi Genoa  transaksikeuanganantarpemerintah yang berkuasadanrakyat

    5. Sejarah Organisasi Sektor Publik • Gereja • Administrasikeuangangerejatelahdilakukandenganrapi • Islam • Pencatatankekayaanmendukungpenghitunganzakatpadazamanpemerintahankhalifah • Baitul mal sebagaibendahara / keuangannegaratelahmemilikipencatatan yang rapi.

    6. Sejarah Organisasi Sektor Publik • Inggris – abad 15 • Pemerintahberusahamelakukanmengatursemuapertahanan. • Pelaporankeuangandirincilebihrinci tenagakerja, metodeproduksi, tipedankualitasbarang, hargapenjualandanmetodepemasaran

    7. Sejarah Organisasi Sektor Publik • Abad 18  Perubahanmendasar • Inisiatifindividulebihdihargaidandiberipeluangseluas-luasnya • Revoluasiindustri • Pengembanganakuntansikeuangandanmanajemendiperusahaanlebihdipicuolehperkembanganpraktikakuntansisektorpublik.

    8. Sejarah Organisasi Sektor Publik • Abad 19-20 • Mulaimenyamakanakuntansisektorpubliksebagaiprosespencatatanpajak yang dipungutolehpemerintah. • Pejabatpubliksebagaipenanggungjawabpengumpulanpajakdanpembelanjaannya. • Dimulainyapraktik audit atasdanapemerintah • Namunpejabatpemerintah yang mengauditjugamemilikitanggungjawabadministrasi lain.

    9. PerkembanganProfesiAkuntanSektorPublik • PerkembanganProfesiAkuntanSektorPublikdiInggris:1880 - Institute of Chartered Accountants - diInggrisdan Wales.1885 - The Corporate Treasurers and Accounting Institute.KemudianmunculOrgaisasi Chartered Institute of Publik Finance and Accounting yang melakukansertifikasiparapekerjadisektorpublik. • Akhirabadke 19, Akuntansidipemerintahdaerahataukotaprajadanperusahaannyadisebut “akuntansisektorpublik”. • PerkembanganProfesiAkuntanSektorPublikdi Indonesia:BerdirinyaIkatanAkuntan Indonesia yang mulaimemunculkanKompartemenAkuntanSektorPublik. Kompartemeninimewadahiparapekerjabidangakuntansidanakuntan yang bekerjadiorganisasisektorpublik.

    10. PengertianOrganisasiSektorPublik 1. Definisi yang dsampaikan Rowan Jones dan Maurice Pendlebury, dalambukunya “Public Sector Accounting” mengatakanSektorpubliksebagai; ”The govenrment provides mesures of the accumulated ‘public sector debt’ and of the public borrowing requirement’ for the year”. 2. Definisidari International Federation of Accountants dalam Pronouncement tahun 2005 yang dinyatakandalam IPSAS: • “the term “public sector” refers to national governments, regional (e.g., state, provincial, territorial) governments, local (e.g., city, town) governments and related governmental entities (e.g., agencies, boards, commissions and enterprises)”. 3. DefinisidariIndrabastian: • “Sektorpublikdalamartianluasdimaknaisebagaibidang yang membicarkanmetodemanajemennegara. • Sektorpublikdalamartiansempitdimaknaisebagaipembahasanpajakdankebijakanperpajakan”.

    11. lanjutan 4. Rosjiditahun 2001: ” birokrasi dan kesatuan ekonomi yang ditangani olehpemerintahsesuaidengankewenangannyadalamrangkamemerankanfungsiuntuk: • alokasisumber-sumberekonomi yang langka, • redistribusipendapatan, • pengendalianstabilitasekonomi, serta • penyediaanbarangdanjasapublik yang tidakbisadisediakanolehsektorswasta, denganmaksuduntukmeningkatkankesejahteraandan palayanan umum kepada masyarakat (publik)”. 5. PengertianOrganisasiSektorPublikadalahsuatuentitas yang memilikiaktivitasberhubungandenganusahauntukmenghasilkanbarangdanlayananpublikdalamrangkamemenuhikebutuhandanhakpublik (Mardiasmo, 2002).

    12. RuanglingkupOrganisasi SP • Adapun domain organisasisektorpublikdiwilayahRepublik Indonesia secara struktural meliputi (Rosjidi 2001): • Lembaga-lembaga Negara • PemerintahPusatdanInstansiVertikalPemerintahPusatdi Daerah • Pemerintah Daerah • Unit Swadana • AparaturPerekonomian Negara dan Daerah • Domain atauruanglingkup yang dimaksudadalah (Mardiasmo, 2002): • Badan-badanpemerintahan (pemerintahpusat, daerah, dan unit kerja pemerintah). • Perusahaan miliknegara (BUMN, BUMD, BHMN), yayasan, organisasi politik dan organisasi masa, LembagaSwadayaMasyarakat (LSM), Universitas, danorganisasinirlabalainya.

    13. Bentuk-bentukorganisasiSektorPublik: • Pemerintahan (Governmental) • Lembagapendidikan (educational) • Kesehatandankesejahteraan (hospital and welfare) • Keagamaan (religious) • Lembagaamal (charitable) • Lembagadana (foundation)

    14. HubunganAkuntansiprivatdenganAkuntansisektorpublik • Akuntansisesuaidomainnyamenjadidisiplinilmu yang memfasilitasibagiorganisasidalamupayapenataanterhadappengelolaansumberdaya yang dimilikisuatuentitasorganisasitersebutberikutprosespelaporansebagaiwujudpertanggungjawabannya

    15. SISTEM PENGUKURAN KINERJA • Setelahsuatusistempengelolaankeuanganterbentuk, perludisiapkansuatualatuntukmengukurkinerjadanmengendalikanpemerintahan agar tidakterjadi KKN (Korupsi, Kolusi, danNepotisme), tidakadanyakepastianhukumdanstabilitaspolitik, danketidakjelasanarahdankebijakanpembangunan (Mardiasmo, 2002a). • Pengukurankinerjamemilikikaitaneratdenganakuntabilitas, sepertihalnyaakuntabilitasmemilikikaitaneratdengan NPM. Untukmemantapkanmekanismeakuntabilitas, diperlukanmanajemenkinerja yang didalamnyaterdapatindikatorkinerjadan target kinerja, pelaporankinerja, danmekanismereward and punishment (Ormond and Loffler, 2002). Indikatorpengukurankinerja yang baikmempunyaikarakteristikrelevant, unambiguous, cost-effective, dansimple (Accounts Commission for Scotland, 1998) sertaberfungsisebagaisinyalatau alarm yang menunjukkanbahwaterdapatmasalah yang memerlukantindakanmanajemendaninvestigasilebihlanjut (Jackson, 1995). • Tuntutanbarumuncul agar organisasisektorpublikmemperhatikanvalue for money yang mempertimbangkaninput, output, danoutcomesecarabersama-sama. Dalampengukurankinerjavalue for money, efisiensidapatdibagimenjadidua, yaitu: efisiensialokasi (efisiensi 1), danefisiensiteknisataumanajerial (efisiensi 2). Efisiensialokasiterkaitdengankemampuanmendayagunakansumberdayainputpadatingkatkapasitas optimal. Efisiensiteknisterkaitdengankemampuanmendayagunakansumberdayainputpadatingkatoutputtertentu (dapatdilihatpadaGambar 1).

    16. PengukuranKinerjaSektorPublik

    17. Public Scorecard • Sistemmanajemenstrategikberbasis BSC yang mengakomodasikonsep-konsepdiatassepertivalue for money, NPM, danbest valuemeliputisistempengukurankinerja. Scorecardsektorpublikberbedadenganscorecardsektorswasta, karenasektorpubliklebihberfokuspadapelayananmasyarakatbukanpada profit, tidakmempunyaishareholders, lebihberfokuspadakondisi regional dannasional, lebihdipengaruhiolehkeadaanpolitik, danmempunyaistakeholders yang lebihberagamdibandingkandengansektorswasta. • Scorecardmerefleksikanukurankinerjakomprehensif yang mencerminkanlingkungankompetitifdanstrategi yang digunakan. Scorecard berfokuspadastrategi yang diterapkanbukanpadapengendalianpenerapanscorecard(Hoque, 2002), meskipunpengawasanterhadapscorecardperludilakukanmengingatfokusstrategiterusberubahseiringdenganperubahankondisisosialekonomimasyarakat (Accounts Commission for Scotland, 1998). • PengukurankinerjadilakukandenganmempertimbangkanempatperspektifBSCyaituperspektiffinancial, customer, internal business danlearning and growth (Kaplan and Norton, 1992 dalamQuinlivan, 2000) secaraproporsional. Dengandemikian, pemerintahseharusnyatidakhanyadiukurdengankinerjakeuangan, tetapijugakinerjanyadalammemenuhikebutuhanmasyarakatsecaraekonomis, efisien, dantepatsasaran.

    18. Faktor Tujuan Organisasi Nir laba (non profit oriented) Faktor Tujuan Organisasi Laba (profit oriented) E. PERBEDAAN ORGANISASI SEKTOR PUBLIK DENGAN SEKTOR SWASTA SEKTOR PUBLIK SEKTOR SWASTA Contoh; Puskemas Tujuandidirikaanya; 1. Pelayananbidangkesehatan Contoh; Alfamart, Indomart, carefour dsb. Tujuannya adalah; Tujuan ekonomis Tujuan sosial

    19. Lanjutan … PT Pertamina, Tujuandidirikannyaadalah; • Mengusahakankeuntunganberdasarkanprinsippengelolaan Perseroan secaraefektifdanefisien. • Memberikankontribusidalammeningkatkankegiatanekonomiuntukkesejahteraandankemakmuranrakyat.

    20. lanjutan Tujuan BPK PerwakilanSumsel; • Mewujudkan BPK sebagailembagapemeriksakeuangannegara yang independendanprofesional • Memenuhisemuakebutuhandanharapanpemilikkepentingan • Mewujudkan BPK sebagaipusat regulator dibidangpemeriksaanpengelolaandantanggungjawabkeuangannegara • Mendorongterwujudnyatatakelola yang baikataspengelolaandantanggungjawabkeuangannegara

    21. E. PERBEDAAN ORGANISASI SEKTOR PUBLIK DENGAN SEKTOR SWASTA SEKTOR PUBLIK SEKTOR SWASTA • Faktor Sumber Pembiayaan Organisasi • Pajak, • retribusi, • laba BUMN/BUMD, • utang, • obligasi pemerintah, • charging for services, • privatisasi • Faktor Sumber Pembiayaan Organisasi • Internal: • LYD, • modal, • penjualan aktiva. • Eksternal: • Hutang

    22. Faktor Pola Pertanggungjawaban Organisasi: Pemerintah Pusat Forum Rapat Paripurna DPR RI Laporan Pertanggungjawaban Kepala Negara Pemerintah Daerah Forum Rapatparipurna DPRD Laporanpertanggungjawban Faktor Pola Pertanggungjawaban Organisasi: Perusahaan Terbatas (PT); Rapat Umum Pemegang Saham, (RUPS) Laporan Kinerja, Laporan KEuangan Stakeholder parapemegangsaham Lanjutan perbedaan… Publik Swasta

    23. Lanjutan perbedaan… Swasta Publik • Faktor Struktur organisasi Organisasi: • Birokratis, • kaku, • Hirarkis • Sesuai dengan regulasi yang mengatur • Tidak dapat diubahsesuai keinginan manajemen • Faktor Struktur organisasi Organisasi: • Flexible, • datar, • piramid • Dapatdiubahsesuaikebutuhanmanajemen • Dapatdikembangkansesuaikebutuhandankeinginanmanajemen

    24. Karakteristik anggaran dan stakeholder Organisasi Terbuka untuk publik Karakteristik anggaran dan stakeholder Organisasi Tertutup untuk publik Lanjutan perbedaan… • Faktor Sistem akuntansi • Kas atau modifikasian • Faktor Sistem akuntansi • Akrual

    25. Regulasiterkaitdenganproduk: Tergantung Regulasi Regulasiterkaitdenganproduk: Tergantung pasar Lanjutan perbedaan… • Faktor Pengendalian dan penilaian terhadap Kinerja : • Realisasi Anggaran • Faktor Pengendalian dan penilaian terhadap Kinerja : • ROI, Net Incomes Sales

    26. Lanjutan perbedaan… Disamping perbedaan diatas masih ada perbedaan seperti yang ditulis oleh Norman Flyn dalam bukunya ”The Public sector Management” yang menyebutkan: • Public goods and services sebagai eksternalitas atau sebagai benefit. • Bagaimana layanan yang dihasilkan tersebut didanai? • Siapa yang memiliki fasilitas layanan dan dikelola oleh siapa? • Apakah public goods and services dinikmati oleh orang yang membayar saja atau oleh setiap orang? Pembedaan tersebut diatas lebih ditekankan pada aspek public goods and services.

    27. F. PERSAMAAN KARAKTERISTIK ORGANISASI SEKTOR PUBLIK DENGAN ORGANISASI SWASTA • Kedua sektor tersebut, yaitu sektor publik dan sektor swasta merupakan bagian utuh atau satu kesatuan dari sistem ekonomi makro di suatu negara dan keduanya menggunakan sumber daya yang kurang lebih juga relatif yang sama untuk mencapai tujuan organisasi masing-masing. • Keduanya menghadapi masalah yang kurang lebih juga sama, yaitu masalah kelangkaan terhadap keberadaan atau ketersediaan sumber daya (scarcity of resources), sehingga baik sektor publik maupun sektor swasta dituntut untuk menggunakan sumber daya organisasi secara ekonomis, efektif dan efisien (value for money). • Keduanya sama-sama menerapkan saintifik manajemen dalam proses pengelolaan sumberdaya yang dimiliki.

    28. Lanjutanpersamaan… • Proses pengendalian manajemen, termasuk manajemen saintifik keuangan, pada dasarnya sama di kedua sektor. Kedua sektor sama-sama membutuhkan informasi yang handal dan relevan untuk melaksanakan fungsi manajemen, yaitu: Perencanaan, pengorganisasian, dan pengendalian. • Pada beberapa hal, kedua sektor menghasilkan produk yang sama, misalnya: baik pemerintah maupun swasta sama-sama bergerak di bidang transportasi massa, pendidikan, kesehatan, penyediaan energi, telekomunikasi dan sebagainya. • Kedua sektor terikat pada peraturan perundangan dan ketentuan hukum lain yang disyaratkan pada masing-masing organisasi.

    29. KeuanganPublik • Keuanganpublikadalahbagianilmuekonomi yang mempelajariaktivitasfinansialpemerintah. Yang termasukpemerintahdisiniadalahseluruhunit pemerintah dan institusi atau organisasi pemegang otoritas publik lainnya yang dikendalikandandidanaiolehpemerintah. • Keuanganpublikmenjelaskanbelanjapublikdanteknik-teknik yang digunakanolehpemerintahuntukmembiayaibelanjatersebut. • Keuanganpublikjugamenganalisispengeluaranpublikuntukmembantukitadalammemahamimengapajasatertentu harus disediakan oleh negara dan mengapa pemerintah menggantungkannya pada jenis-jenis pajak tertentu. • Dalam keuangan publik, sebagaicontoh, uraian-uraianmengapapertahanannasionalharusdikelolaolehnegarasedangkanmakanandiserahkankepadaswastadanmengapasuatunegaramenggunakankomposisiberbagaijenispajak - bukanpadapajaktunggal - merupakanhal-hal yang dibahasdidalamnya.

    30. RuangLingkupKeuanganPublik • RuanglingkupKeuanganPublikdapatdigambarkandalambaganberikutini. Pendapatan : Pajak Non Pajak Hutang INTERVENSI PEMERNTAH Eksternalitiasbarangdanjasapublik InforTidakLengkap Ketiadaanpasar StabilitasEkonomi Pemerntah AnalisaPEndapatan PILIHAN PUBLIK InstitusiPublik KeseimbanganPublik PemilihanUmum SISI BELANJA Pendidikan Kesehatan Soasial Pertahanandsb

    31. KarakteristikKebijakanpublik 1. Untukmencapaiefisiensipasar - kondisidimanaproduksibarangsamadengankeinginanpasar - mensyaratkanadanyainformasi yang lengkapmenenaipasarbaikbagiprodusenmaupunkonsumendanperaturanpemerintah diperlukan untuk menjamin persyaratan kelengkapan informasiitu. 2. Peraturanpemerintahdiperlukanuntukmengoreksipenyimpangan yang terjadibilaterdapatkondisipersaingan yang tidakefisien. 3. Pertukaranbarangdanjasatertentudalammekanismepasarperluadaproteksidaripemerintahuntukmelindungipelakupasar. 4. Timbulnyamasalaheksternalitas (akandibahaslebihlanjutpadababmendatang) perludipecahkanolehpemerintah, melaluianggaran, subsididanpajak. 5. Perlunya peran sosial yang dilakukan oleh pemerintah dalam distribusi pendapatandankesejahteraandalammekanismepasar. 6. Kebijakanpublikdiperlukanuntukmenjaminkesempatankerja, stabilitashargadantingkatpertumbuhanekonomi.

    32. Kriteria yang DigunakanuntukMengevaluasiKebijakanPublik • 1. Equity & Fairness (Keadilandankewajaran) • Suatukebijakanpublikdapatdiujidenganberbagaipertanyaan: Apa yang dimaksuddengankewajarandalampersepsisosialdanseberapa fair suatukebijakanpublikterhadapisuhakkepemilikan? Sebagaicontoh, apakahwajarmenutupperusahaan yang menyebabkanpolusiudaradibandingkandengankesempatankerja yang disediakanolehusahatersebut? Apakah wajar menutup bisnis penebangan hutan untuk menyelamatkan habitat burunghantu? Atau, apakahwajarbagikeluargatanpaanakharusmembayarpajakpendidikan?

    33. Lanjutan… • 2. Economic Efficiency (EfisiensiEkonomi) • KebijakanpublikdapatdianalisisdarisudutPareto Efficiency yaitualokasisumberdayadarikondisi yang tidakmungkin – melaluiperubahanalokasi – sehinggamencapaikondisidimanaseseorangataubeberapaorangmengalamikepuasanlebihbaiktanpamenyebabkanpihak lain terbebani. • 3. Paternalism (Sistem Paternal) • Kebijakan publik dapat dievaluasi dari asumsi bahwa pemerintah adalah pihak yang paling mengetahuipermasalahanpenduduksuatunegaradanpemerintahbebasmenentukankebijakanapasaja. Sebagaicontoh, orangtidakakanmenabungdalamjumlah yang cukupuntukpensiunsehinggapemerintahharusmengalokasikanpenerimaanpajak agar pendudukusialanjutdapatmemperolehmanfaat.

    34. Lanjutan… • 4. Freedom of choice (KebebasanIndividu) • Dalam asas demokrasi, kebebasan individu dalam perekonomian memungkinkanpertukaransukarelaataumempromosikanprosespengambilankeputusansukarela yang didasarkanataspertimbangandagang yang bebasbiaya transfer antarpihak yang bertransaksi. Sehinggasalahsatuindikatorkeberhasilankebijakanpublikadalahapakahkebijakanpemerintahdapatmendorongkebebasanindividudalambertransaksiekonomi. • 5. Stabilization (Stabilisasi) • Kebijakanpublikdapatdianalisisdenganmenilaiapakahkebijakan yang diambilpemerintahmampumeningkatkanpengeluaranagregat? Atauapakahekonomisektorswasta - yang dapatmemberipekerjaanpadasetiaporang - perludiintervensipemerintah?

    35. Lanjutan… • 6. Trade Off • Secaraumum, ekonommenekankanefisiensidankeadilansebagaikriteriamelakukanevaluasiataskebijakanpublik. Akantetapi, mungkinadakonflik yang substansial antara beberapa kriteria tersebut. • Contoh, kebijakanupah minimum mungkinmendorongkeadilan, tetapihalinimungkintidakefisien. Kemudian, welfare economics telahdipertimangkansebagaicarapemberianinsentifuntukmengoreksikebijakanberdasarkeadilansosial. • Suatukebijakanpublikdapatdievaluasidenganpertanyaanapakahpilihankebijakantidakakanmengorbankantujuanlainnyaatauapakahmanfaatagregatdapatmelampauibebanagregat.

    36. Contoh StrukturOrganisasidiLingkunganPemerintah Daerah Perangkat Daerah Dinas Badan Kantor RumahSakit

    37. Perangkat Daerah Provinsi GUBERNUR DPRD PROV PERANGKAT DAERAH SETDA (unsur staf) Ps. 120 (1) DINAS DRH (unsur pelaksana) LTD (unsur penunjang) SET DPRD (unsur pelayanan) 14 Ps. 120 (1) Ps. 120 (1) Ps. 120 (1)

    38. Perangkat Daerah Kab/Kota BUP/WALKOT DPRD KAB/KOTA PERANGKAT DAERAH SETDA (unsur staf) Ps. 120 (2) DINDA (unsur pelaksana) LTD (unsur penunjang) SET DPRD (unsur pelayanan) Ps. 120 (2) Ps. 120 (2) Ps. 120 (2) KECAMATAN Ps. 120 (2) KELURAHAN Ps. 120 (2) 15

    39. SETDA PROVINSI Eselon I.b. • SEKRETARIAT DAERAH PROVINSI Es. II.a. ASISTEN ASISTEN ASISTEN ASISTEN BIRO = 3 Es. II.b. BAGIAN = 4 Es. III.a. SUBBAG = 3 Es. IV.a. 16 Cat : klasifikasi minimal & sedang = 3 Ass.

    40. SETDA Kab / Kota Eselon II.a. • SETDA KAB / KOTA ASISTEN ASISTEN ASISTEN ASISTEN Eselon II.b. BAGIAN = 4 Eselon III.a. SUBBAG = 3 Eselon IV.a. Cat : klasifikasi minimal & sedang = 3 Ass. 17










    50. RUSD Kls A Es II.a. • RSU Kls. A ROVINSI. WADIR ADM WADIR …. WADIR …. WADIR …. Es II.b. BAG = 3 BID = 3 Es III.b. Es III.b. SEKSI = 2 / JAFUNG Subbag = 3 Es IV.a. Es IV.a. 27