white spot syndrome virus n.
Skip this Video
Loading SlideShow in 5 Seconds..
White Spot Syndrome Virus PowerPoint Presentation
Download Presentation
White Spot Syndrome Virus

Loading in 2 Seconds...

play fullscreen
1 / 20

White Spot Syndrome Virus - PowerPoint PPT Presentation

  • Uploaded on

White Spot Syndrome Virus. Heni Susanti 116080117011004. Latar Belakang. Kegiatan budidaya merupakan salah satu sektor produksi yang berkembang pesat di dunia dan bertujuan untuk meningkatkan produktivitas hasil budidaya .

I am the owner, or an agent authorized to act on behalf of the owner, of the copyrighted work described.
Download Presentation

PowerPoint Slideshow about 'White Spot Syndrome Virus' - zazu

Download Now An Image/Link below is provided (as is) to download presentation

Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author.While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server.

- - - - - - - - - - - - - - - - - - - - - - - - - - E N D - - - - - - - - - - - - - - - - - - - - - - - - - -
Presentation Transcript
white spot syndrome virus

White Spot Syndrome Virus



latar belakang
  • Kegiatanbudidayamerupakansalahsatusektorproduksi yang berkembangpesatdiduniadanbertujuanuntukmeningkatkanproduktivitashasilbudidaya.
  • Udangdanikan air tawarsertaspesieskerangmerupakanindustribudidaya
  • penyakitmenularmenjadimasalahutama, yang menyebabkankerugianuntukparapembudidayaudangdanhasilperikananlainnya.
  • Keberadaanbakteripatogenpadaorganisme yang dibudidayakanseringkalimenimbulkanpenyakitmenularterutamaudangadalahdisebabkanoleh virus, dimana virus mempunyaikemampuan yang sangatcepatdalammenginfeksiudangdanhasilperikananlainnya.
white spot syndrome virus wssv
White Spot Syndrome Virus (WSSV)
  • menginfeksisebagianbesarkeluargakrustaseadansalahsatupatogen yang paling berbahayapadajenisudangbudidayapenaeid. Lebihdari 80 spesies, termasukudang air tawar, ikan, lobster, dankepiting, adalahsebagai host atauagenpembawa WSSV
  • Angkakematiankumulatifudang yang terjangkit virus inibisamencapai 100% dalamwaktu 3-10 hari
ciri ciri
  • WSSV sebagaisatu-satunyaanggotadariWhispovirus yang masukkedalam genus  Nimaviridae.
  • Viriondari WSSV yang ovoid atauelipsoidberbentuk basil,
  • memilikisimetriteratur, danberdiameter70-167 nm dandanberukuran 210-420 nm. 
  • Viral envelop 6-7 nm
  • Mempunyaibenangatauflagelasepertiekstensi (embel-embel) disalahsatuujungvirion. 
  • WSSV pertama kali terdapatdinegarataiwanyaitupadatahun 1992 selanjutnyamenyebardiwilayahjepangdanhampirsemuanegaradiasia
  • Padatahun 1995 wssvmenyerangwilayahamerikayaitudi south texas
  • Padatahun 1999 yang menyebabkankematianpadaudangbudidayadiwilayahequador
  • Untukmenginfeksisel target, suatuvirionmelaluibeberapatahapan yang harusdilaluisampaimenginfeksiseldari host atauinang,
  • Virus RNA biasanyamemilikisatutransmembran (TM) yang tersusunatasglikoprotein yang mengalamikonformasitransisidipicuolehreseptor yang sesuaiatau pH rendah, menyebabkanmasuknyafusipeptidakedalam plasma membranataumembranvesikelendocytic.
  • Berbedadari RNA virus, fusidasardari virus Herpesviridae, keluargabesar virus menyelimuti DNA, termasuktigaglikoproteinspesifikmengikatreseptor protein. Delapan TM protein yang ditemukandiperlukanuntukmasuknya virus vaccinia (VACV
  • virus menyelimuti DNA inangdapatmemanfaatkan protein kompleksuntukmemfasilitasimasuknya virus

WSSV menginfeksisel-selpenghasilmesodermaldanektodermalsepertiepitelsubkutikula, organ limfoid, hemosit, jaringanhematopoietik, epidermis kutikulaperutdanjaringanpenghubung.

  • Indikasiterinfeksinyajaringanditunjukkanolehadanyatitiknekrosis yang tersebar. Sel-sel yang terdegenerasidiitandaidenganadanyainti yang mengalamihiperthrophy (membesar) dengankromatin yang terpinggirkandaninklusiintranukleareosinofilsampaibasofil.
  • Enkapsulasihemositdarisel yang nekrosisterlihatsebagaimassaberwarnacoklatdalamperutdapatdijadikantandaadanyainfeksi. Rata-rata ukuranvirion70 – 150 nm × 250 – 380 nm.
  • Replikasiterjadipadainti, dantidakterjadipembentukanbadanoklusi

infeksi WSSV adalahterjadinyaperubahanselulersehinggaterjadipembengkakanintisel (hipertrofi) olehkarenaperkembangandanpenumpukanvirion yang berkembangdalaminti sel. Intisel yang membengkakakanmenambah volume cairanselsehinggamenyebabkanselpecahkarenamelebihitoleransielastisitasdinding sel. Secarahistologissel yang terinfeksipadatingkatlanjutakanterlihatberwarnabirugelapkarenabersifat basophilic sehinggamenyerappewarnahematoksilin, sedangkanpadatingkatawalakanterlihatberwarnakemerahankarenaintiseltersebutbersifateosinophilic (menyerapwarna eosin)

faktor yang mempengaruhi wssv
Faktor yang mempengaruhi WSSV
  • Fluktuasikualitasair
  • Suhu
pencegahan terhadap serangan virus white spot syndrome virus
Pencegahanterhadapserangan virus white spot syndrome virus
  • sinarultraviolet
  • Vaksinasi
  • Imunostimulan
  • Ekstraktumbuhan herbal
sinar ultraviolet
Sinar ultraviolet

Pengaruhsinar ultraviolet terhadap virus adalahpadaperusakanasamnukleatyaitudenganterjadinyaikatankovalenantaraduamolekulpirimidinberdekatanmembentukderivatsiklobutan, akhirnyamengakibatkanketidakmampuanasamnukleatbereplikasi. Sinar ultraviolet jugamenyebabkanikatansilang (cross link) antaraduarantai DNA danpembentukanfotohidrat (derivat 6 hidroksi 5-6 dihidro) yang keduanyaberperandalammekanismeinaktifasi. Padadosisradiasi yang cukuptinggi, asamnukleatbahkankapsid (protein) menjadirusaksehingga virus kehilangankemampuanuntukmengadakaninterfensi, haemoglutinasidansifat -sifatkhaskeantigenannya

  • Kebanyakanpadainvertebratatidakmemilikikekebalanadaptifdansistempertahananterhadapkekebalantubuhtergantungpadaberbagaimekanismekekebalanbawaantermasukresponselulerdanhumoral
  • Penggunaan protein recombinanuntukmengatasi virus WSSV telahdigunakanyaitudengancaramenginduksiudangdenganvaksin rVP28
  • Imunostimulanmeningkatkanresponhumoraldanselulerdengancaraspesifikdan non-spesifik.
  • Imunostimulansangatefektifuntukpencegahandanpengendalianpenyakitikandanorganismelainnyadalamaquakulturkarenaselainsebagaialternatifdanpengobatanlengkapuntukvaksinasi.
  • ß-Glucantelahdigunakanuntukmeningkatkanketahanandikrustaseaterhadapinfeksi virus danbakteri. Glucanmemilikisifatimunostimulandanbekerjadenganbaikketikadisuntikkanatauditambahkanpadamakananuntukikandanorganismebudidaya.
ekstrak tumbuhan herbal
Ekstraktumbuhan herbal
  • Untukmengatasiinfeksi virus dapatdilakukandenganpropilactinataudapatjugamenggunakanekstraktumbuhan herbal untukmenekan virus padaudangantara lain dapatmenggunakanekstrakmetanoldari lima tumbuhanindiaCynodondactylon, Aeglemarmelos, Tinosporacordifolia, Picrorhizakurooa and Eclipta alba
  • White Spot Syndrome Viruses (WSSV) penyakit yang disebabkan virus yang sifatnyamudahmenularpadaudangpenaeid. Angkakematiankumulatifudang yang terjangkit virus inibisamencapai 100% dalamwaktu 3-10 hari
  • White spot syndrome virus tidakhanyamenyerangpadaudangtetapijugamenyerangdekapoda lain. WSSV menginfeksipadabagianjaringandan organ danbereplikasipadabagianintisel yang terinfeksi. Padatahapakhirinfeksibaikintimaupunisiselhancur, dankehilanganstrukturseluler
  • Pencegahanwhite spot syndrome virus dapatdilakukandenganbeberapacararadiasi ultraviolet, vaksinasi, pemberianpakan yang mengandungsenyawaantioksidansepertifukoidandanpenggunaanimmunostimulantseperti β-glucandengandosistertentu

Thank you

Wassalamualaikum. Wr.wb