1 / 19

Computational Biochemistry

This guide provides an overview of essential bioinformatics resources, focusing on PubMed, BLAST, and other databases like PDB and KEGG. PubMed, developed by the NCBI, offers access to over 18 million biomedical citations, enabling researchers to find relevant articles since 1948. Key tools discussed include advanced search options, sequence retrieval, and multiple sequence alignment techniques. The resource assists in obtaining high-quality DNA and protein sequences and supports better scientific research by streamlining the search process.

Download Presentation

Computational Biochemistry

An Image/Link below is provided (as is) to download presentation Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author. Content is provided to you AS IS for your information and personal use only. Download presentation by click this link. While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server. During download, if you can't get a presentation, the file might be deleted by the publisher.

E N D

Presentation Transcript


  1. Fatih University Computational Biochemistry

  2. Pubmed • Retrieving DNA and Protein Sequences • BLAST • Multiple Sequence Alignment • Others (PDB, KEGG, BREND) Outline

  3. A scientific search engine • e-adress:http://www.ncbi.nlm.nih.gov/pubmed • developed by the National Center for Biotechnology Information (NCBI) at the National Library of Medicine (NLM), located at the U.S. National Institutes of Health (NIH) • A service that includes over 18 million citations from MEDLINE and other life science journals for biomedical articles back to 1948. PubMed includes links to full text articles and other related resources. Pubmed

  4. bilimsel internet araştırması. O konu ile alakalı çıkmış bilimsel makaleleri araştırır • Bilimsel araştırmalarda problemler • çok fazla sonuç • lüzumsuz sonuç • Pubmed’in çözümü • ileri arama opsiyonu • limitasyon Pubmed ne yapar?

  5. örnek: • www.pubmed.com • sorgu (query) gir.

  6. sorgu: • bir yıl içinde • pylori hakkında • Türkiyede yapılan • ingilizce • makaleler • bedava makaleler Örnek Aramalar

  7. “Server” hizmet vermekte • en önemlisi NCBI ve expasy’de • Amaç: ilgilendiğimiz bir proteinin protein sekansının bulunması • En güvenilir: expasy • iki database bulunmakta: Swiss-prot ve TrEMBL • Swiss-prot: bire bir protein bilgileri uzmanlarca doldurulan • TrEMBL: Bilgisayarlı Protein Sekansı Bulma

  8. www.google.com • expasy yaz • tıkla Expasy’e ulaşım

  9. ister DNA ister protein sekansı olsun. Sekansların tüm biyoenformatik araçları tarafından tanındığı sekans yazılım formatının adı FASTA formatıdır başta > işareti içerir ve sonrasında bilgilendirme gelir. ikinci satır sekansı içerir >sp|P41022|URE3_BACPA Urease subunit gamma OS=Bacillus pasteurii GN=ureA PE=1 SV=1 MHLNPAEKEKLQIFLASELLLRRKARGLKLNYPEAVAIITSFIMEGARDGKTVAMLMEEGKHVLTRDDVMEGVPEMIDDIQAEATFPDGTKLVTVHNPIS FASTA formatı

  10. en iyi adres NCBI’ın genveri bankalarıdır. DNA sekansı

  11. NCBInucleotidesorguyu yaz • Sorgu: urease pylori örnek

  12. değişik BLAST (basic local alignment search tool) yöntemleri var. BLAST: sekans karşılaştırma

  13. sekansınıza neler benziyor • primer’larınız o bölgeye özgün mü? • sekansınızın fonksiyonu bilinmiyorsa, tahmin • alignment öncesi aday sekansları bulma BLAST neden kullanılır?

  14. urease yapalım örnek

  15. birden fazla sekansı sıralarız (alignment) • Ne faydası var: • farklılık göstermeyenbölgeler tesbit edilir. • yapı-fonskiyon ilişkisi • filogenetik ağaç öncesi • vb • en çok kullanılan • Clustal W, Tcoffee multiple (sekuence) alignment

  16. expasy ile bir örnek örnek

  17. Enzimlerle alakalı her türlü bilgi • makalelerden çıkarılıp analşılır • brenda: http://www.brenda-enzymes.org/ • nasıl bulunur: google’dan brenda yaz • ureaz’ı incele Enzim veri bankası

  18. Kegg en popüler verbankası Metobolisma

  19. PDB Proteinlerin 3D’si

More Related