slide1
Download
Skip this Video
Download Presentation
HABIB ADJIE S.H. (UNISBA) NOTARIS (UNPAD) M.Hum . (UNDIP) Dr. (UNAIR) NOTARIS – PPAT – PL II

Loading in 2 Seconds...

play fullscreen
1 / 522

HABIB ADJIE S.H. (UNISBA) NOTARIS (UNPAD) M.Hum . (UNDIP) Dr. (UNAIR) NOTARIS – PPAT – PL II - PowerPoint PPT Presentation


  • 277 Views
  • Uploaded on

HABIB ADJIE S.H. (UNISBA) NOTARIS (UNPAD) M.Hum . (UNDIP) Dr. (UNAIR) NOTARIS – PPAT – PL II KOTA SURABAYA. Jalan Tidar No. 244 Surabaya. Telp . 031 – 5483881, 08121652894. Fax. 031 – 5469853 E-mail : [email protected] Web B log : habibadjie.dosen.narotama.ac.id. ATURAN KULIAH.

loader
I am the owner, or an agent authorized to act on behalf of the owner, of the copyrighted work described.
capcha
Download Presentation

PowerPoint Slideshow about 'HABIB ADJIE S.H. (UNISBA) NOTARIS (UNPAD) M.Hum . (UNDIP) Dr. (UNAIR) NOTARIS – PPAT – PL II' - urit


An Image/Link below is provided (as is) to download presentation

Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author.While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server.


- - - - - - - - - - - - - - - - - - - - - - - - - - E N D - - - - - - - - - - - - - - - - - - - - - - - - - -
Presentation Transcript
slide1
HABIB ADJIE

S.H. (UNISBA)

NOTARIS (UNPAD)

M.Hum. (UNDIP)

Dr. (UNAIR)

NOTARIS – PPAT – PL II

KOTA SURABAYA.

JalanTidar No. 244 Surabaya.

Telp. 031 – 5483881, 08121652894.

Fax. 031 – 5469853

E-mail : [email protected]

WebBlog : habibadjie.dosen.narotama.ac.id

aturan kuliah
ATURAN KULIAH

Toleransi terlambat 20 menit (bagi mahasiswa dan dosen)

HP off.

Kehadiran mengikuti kuliah minimal 75% (jika tidak terpenuhi tidak dapat ikut ujian akhir)

Pakaian sopan, tidak pakai kaos oblong, sandal jepit

Jika berhalangan hadir :

- sakit (1 hari ijin tertulis),

- sakit 1 hari (surat keterangan dokter),

- musibah, harus dengan bukti tertulis yang relevan

slide3

BAHAN AJAR POLITIK HUKUMKENOTARIATANPROGRAM STUDIMAGISTER KENOTARIATANFAKULTAS HUKUMUNIVERSITAS NAROTAMASURABAYA

kuliah 01
KULIAH 01

PENGERTIAN DAN RUANG LINGKUP POLITIK HUKUM

slide5
PENDAHULUAN

Moh. Mahfud MD, dalam disertasinya menyebutkan bahwa

Tidak sedikit dari para mahasiswa hukum yang heran dan masygul ketika melihat bahwa hukum ternyata tidak seperti dipahami dan dibayangkan ketika di bangku kuliah. Mereka heran ketika melihat bahwa hukum tidak selalu dapat dilihat sebagai penjamin kepastian hukum, penegak hak-hak masyarakat, penjamin keadilan. Banyak sekali peraturan hukum yang tumpul,tidak mempan memotong kesewenang-wenangan, tidak mampu menegakkan keadilan dan tidak dapat menampilkan dirinya sebagai pedoman yang harus diikuti dalam menyelesaikan berbagai kasus yang seharusnya bisa dijawab oleh hukum. Bahkan banyak produk hukum yang lebih banyak diwarnai oleh kepentingan-kepentingan politik pemegang kekuasaan dominan.

Mereka bertanya : mengapa hal itu harus terjadi?

slide6
Ternyatahukumtidakseterildarisubsistemkemasyarakatanlainnya. Politikkerapkalimelakukanintervensiataspembuatandanpelaksanaanhukumsehinggamunculjugapertanyaanberikutnyatentangsubsistemmanaantarahukumdanpolitik yang dalamkenyataannyalebihsuprematif. Dan pertanyaan-pertanyaan lain yang lebihspesifik pun dapatmengemukasepertibagaimanakahpengaruhpolitikterhadaphukum, mengapapolitikbanyakmengintervensihukum, jenissistempolitik yang bagaimana yang dapatmelahirkanprodukhukum yang berkaraktersepertiapa. Upayauntukmemberijawabanataspertanyaan-pertanyaandiatasmerupakanupayayangsudahmemasukiwilayahpolitikhukum.
slide7
Politik Hukum secara sederhana dapat dirumuskan sebagai kebijaksanaan hukum (legal policy) yang akanatautelahdilaksanakan secara nasionalolehpemerintah; mencakup pula pengertiantentangbagaimanapolitikmempengaruhihukumdengan cara melihat konfigurasi kekuatan yang ada di belakang pembuatan dan penegakannya.
  • Di sini hukum tidak dapat hanya dipandang sebagai pasal-pasal yang bersifat imperatif atau keharusan-keharusan yang bersifat das sollen, melainkan harus dipandang sebagai subsistem yang dalam kenyataan (das sein) bukan tidak mungkin sangat ditentukan oleh politik, baik dalam perumusanmateri dan pasal-pasalnyamaupundalamimplementasi dan penegakannya.
slide8
Mahfud sendiri menyatakan bahwa hukum terpengaruh oleh politik karena subsistem politik memiliki konsentrasi energi yang lebih besar daripada hukum.Untuk menghadapi anggapan tersebut sebagai wujud kegalauan,kita harus – dari sekarang – mengedepankan subsistem hukum yang memiliki konsentrasi yang lebih besar daripada politik. Hal ini semata-mata untuk mewujudkan supremasi hukum. Salah satu cara untuk mengedepankan hukum adalah bagaimana menegakkan suatu undang-undang yang didahului dengan memberikan pemahaman yang baik dan mendalam tentang substansi undang-undang, salahsatunya, melalui sosialisasi kepada masyarakat, bahwa dalam membentuk Peraturan Perundang-undangan harus berdasarkan pada asas pembentukan peraturan perundang-undangan yang baik, yakni pembentukannya harus dapat dilaksanakan, adanya kedayagunaan dan kehasilgunaan, dan kejelasan rumusan.
slide9
Moh. Mahfud MD selanjutnya berpendapat bahwa hukum merupakan produk politik yang memandang hukum sebagai formalisasi atau kristalisasi dari kehendak-kehendak politik yang saling berinteraksi dan saling bersaingan. Ia juga menekankan bahwa politik hukum merupakan bagian dari ilmu hukum.

Jika ilmu hukum diibaratkan sebagai sebuah pohon, maka filsafat merupakan akarnya, sedangkan politik merupakan pohonnya yang kemudian melahirkan cabang-cabang berupa berbagai bidang hukum seperti hukum pidana, hukum perdata, hukum tata negara,hukum administrasi negara, dan bidang hukum lainnya.

slide10
PandanganMahfud di atas menggambarkankeadaanpembentukanundang-undang di Indonesia yang menitikberatkan pada politikdaripadahukum, walaupunprodukakhirpolitiktersebuttetapsebagaiprodukhukum yang harusdipatuhiolehseluruhmasyarakat.

Halinilah yang belumdisadariolehpembentukundang-undangbahwakeputusanpolitik yang dituangkandalamsuatuundang-undangmerupakanprodukhukum yang secara yuridis, isinyaharusdilaksanakan, walaupunkemudiandisadaribahwaundang-undangtersebutsulitdilaksanakankarenasubstansinyasaratdenganelemen-elemenpolitik

slide11
Meskipundemikianharusdiciptakansinergiantarakepentinganpolitikdanhukum yang selalumengedepankankepentingannegara, masyarakat, bukanmengedepankankepentingankelompok-kelompokataupartai-partaipolitik agar kepentingannyadiakomodasikandalamundang-undang yang dibuatnya.
slide12
SESUAI DENGAN PERJALAN WAKTU STUDI HUKUM BERUSIA SUDAH SANGAT LAMA MULAI DARI YUNANI KUNO SAMPAI ZAMAN MODERN SEKARANG INI. DALAM KURUN WAKTU ITU STUDI HUKUM TELAH MENGALAMI PASANG NAIK DAN SURUT, PERKEMBANGAN DAN PERGESERAN MENGENAI METODOLOGI PENDEKATANNYA. PASANG SURUT PERKEMBANGAN HUKUM TERSEBUT TIDAK LEPAS DARI PERUBAHAN STRUKTUR SOSIAL AKIBAT MODERNISASI INDUSTRIALISASI, EKONOMI, POLITIK, PERKEMBANGAN PERANGKAT LUNAK.
slide13
SATJIPTO RAHARJO MENGURAIKAN PERKEMBANGAN HUKUM, DIMANA ABAD KE 19 DI EROPA DAN AMERIKA SERIKAT INDIVIDU MERUPAKAN PUSAT PENGATURAN HUKUM, SEDANGKAN BADAN HUKUM /LEMBAGA HUKUM YANG BERKEMBANG ADALAH BADAN HUKUM PERDATA. KEAHLIAN HUKUM DIKAITKAN DENGAN KETERAMPILAN TEKNIS ATAU KEAHLIAN TUKANG (SIAP KERJA). KETIKA ITU STUDI HUKUM DAPAT DIKAJI DARI HUKUM SENDIRI, HUKUM TIDAK MEMERLUKAN BANTUAN DAN KERJASAMA DENGAN DISIPLIN LAIN.
slide14
DENGAN KEMAJUAN TEKNOLOGI DAN MODERNISASI DALAM SEGALA ASPEK KEHIDUPAN, KEDUDUKAN INDIVIDU MULAI MENDAPAT SAINGAN OLEH TAMPILNYA SUBJEK HUKUM LAIN SELAIN PERDATA SEPERTI COMUNITY, KOLEKTIVE DAN NEGARA. DENGAN DEMIKIAN BIDANG-BIDANG YANG MAKIN MENONJOL ADALAH BIDANG HUKUM PUBLIK, HUKUM ADMINISTRASI DAN HUKUM SOSIAL EKONOMI.
slide15
DALAM PERKEMBANGAN DEWASA INI, HUKUM DAPAT DILIHAT DARI DIMENSI YANG SANGAT KOMPLEKS. MEMPELAJARI HUKUM SAAT INI TIDAK BISA LEPAS DARI KAJIAN DISIPLIN ILMU LAINNYA. ARTINYA HUKUM TIDAK BISA DIPELAJARI DARI SUDUT PANDANG HUKUM SEMATA-MATA. AHLI HUKUM TIDAK BISA MENUTUP DIRINYA SEPERTI PAHAM / AJARAN HUKUM MURNI DARI HANS KELSEN YANG MENGATAKAN HUKUM HARUS MURNI (STERIL) DARI PENGARUH FAKTOR-FAKTOR NON YURIDIS, SEPERTI FAKTOR SOSIAL, MORAL, POLITIK, AGAMA DAN LAIN-LAIN ATAU MEMPELAJARI HUKUM JANGAN MEMAKAI KACAMATA KUDA ATAU DEWI KEADILAN YANG MENUTUP KEDUA MATANYA DAN MEMBAWA PEDANG.
slide16
Melihat perkembangan hukum sekarang ini yang dapat memasuki ruang dan wilayah ilmu-ilmu yang lain. Sehingga hukum sebagai suatu sistem bidang yang normatif, praktis tidak dapat berdiri sendiri dengan melepaskan diri untuk tidak berinteraksi dengan ilmu-ilmu yang lainnya atau para ahli ilmu hukum jangan seperti memakai "kaca mata kuda"yang tidak melihat ke kiri dan ke kanan.

Spesialisasi dan spesifikasi keilmuan memang sangat diperlukan tapi bukan berarti memandang dengan sebelah mata ilmu yang lain, tapi lintas berbagai bidang keilmuan tetap diperlukan untuk mencapai kemaslahatan bagi semua orang.

slide17
PERSOALAN HUKUM SANGAT KOMPLEKS, KARENA ITU PENDEKATANNYA BISA DARI MULTI DISIPLIN ILMU BAIK SOSIOLOGI, FILSAFAT, SEJARAH, AGAMA, PSIKOLOGI, ANTROPOLOGI, POLITIK DAN LAIN-LAIN. KETIKA KITA BERBICARA HUKUM AGRARIA (HUKUM PERTANAHAN) INI TIDAK BISA DILEPASKAN DARI ASPEK SEJARAH, FILSAFAT. KETIKA KITA BERBICARA HUKUM TENTANG PEMILIHAN UMUM, PENDEKATAN POLITIK SANGAT KENTAL. DALAM PERKEMBANGAN HUKUM PEMERINTAHAN DI DAERAH PENDEKATAN POLITIK SANGAT MEMPENGARUHI DEMIKIAN JUGA KETIKA KITA BERBICARA HUKUM PERBANKAN DAN SEBAGAINYA. HARUS ADA SINERGIS YANG AKTIF DARI BERBAGAI DISIPLIN ILMU-ILMU TERSEBUT.
slide18
PENDEKATAN HUKUM MELALUI MULTI DISIPLIN TERSEBUT TELAH MELAHIRKAN BERBAGAI DISIPLIN HUKUM DI SAMPING PHILOSOPHY OF LAW DAN SCIENCE OF LAW, JUGA SEPERTI TEORI HUKUM (LEGAL THEORY/THEORY OF LAW), SEJARAH HUKUM (HISTORY OF LAW), SOSIOLOGI OF LAW, ANTHROPOLOGY OF LAW, COMPARATIVE OF LAW, PHYCHOLOGY OF LAW DAN SEKARANG POLITIC OF LAW.
slide19
HUKUM MERUPAKAN ENTITAS YANG SANGAT KOMPLEKS, MELIPUTI KENYATAAN KEMASYARAKATAN YANG MAJEMUK, MEMPUNYAI BANYAK ASPEK, DIMENSI DAN FASE. HUKUM TERBENTUK DALAM PROSES INTERAKSI BERBAGAI ASPEK KEMASYARAKATAN (POLITIK, EKONOMI, SOSIAL, BUDAYA, TEKNOLOGI, KEAGAMAAN DAN SEBAGAINYA).
slide20
JIKA HUKUM HANYA DIPELAJARI SEBAGAI PASAL-PASAL DAN DILEPAS DARI KAJIAN NORMA DAN SEGI YANG MEMPENGARUHINYA DAPAT MENYEBABKAN KITA FRUSTRASI DAN KECEWA BERKEPANJANGAN. KETIKA KEKUASAAN MEMPENGARUHI KEPUTUSAN HUKUM (HAKIM), KETIKA DPR (PARLEMEN) MENGOTAK-ATIK PASAL-PASAL RUU MENURUT KEPENTINGAN PARTAI MEREKA (BUKAN UNTUK RAKYAT) KETIKA ITU HUKUM SUDAH MENGHAMBAKAN DIRINYA UNTUK POLITIK.
slide21
VON KIRCHMAN MENGATAKAN BERGUDANG-GUDANG BUKU UNDANG-UNDANG YANG ADA DI DALAM PERPUSTAKAAN BISA DIBUANG SEBAGAI SAMPAH YANG TAK BERNILAI KETIKA ADA KEPUTUSAN POLITIK DI PARLEMEN YANG MENGUBAH ISI UNDANG-UNDANG TERSEBUT. UNGKAPAN ITU TIDAK BERLEBIHAN MELIHAT REALITAS YANG TERJADI DI INDONESIA SAAT INI. KETIKA SISTEM PEMILIHAN LEWAT PERWAKILAN (MPR, DPR, DPRD UNDANG-UNDANGNYA DIOBOK-OBOK DENGAN SISTEM PEMILIHAN LANGSUNG), BANYAK BUKU-BUKU TENTANG SISTEM PEMILIHAN MELALUI PERWAKILAN DI INDONESIA YANG TIDAK BERGUNA.
slide22
SALAH SATU PENDEKATAN HUKUM YANG MARAK DIBICARAKAN DALAM BERBAGAI DISKURSUS ADALAH PENDEKATAN HUKUM DARI POLITIK. HAL INI AKHIRNYA MELAHIRKAN KAJIAN BARU DI FAKULTAS HUKUM YANG DIKENAL DENGAN POLITIK HUKUM. AWALNYA KAJIAN POLITIK HUKUM HANYA DIAJARKAN DI PROGRAM MAGISTER ( S-2), TETAPI SEKARANG HAMPIR SELURUH TINGKATAN S-1 PROGRAM STUDI ILMU HUKUM SUDAH DIAJARKAN MATA KULIAH POLITIK HUKUM.
slide23
PERSOALAN YANG BELUM DAPAT JAWABAN YANG PASTI ADALAH KAPAN SIAPA DAN KAPAN POLITIK HUKUM YANG MEMPOPULERKAN POLITIK HUKUM. NAMUN BELLEFROID TAHUN 1953 MENGGUNAKAN ISTILAH DE RECHTSPOLITIEK YANG KEMUDIAN DIKENAL DENGAN POLITIK HUKUM SEBAGAI SUATU ISTILAH MANDIRI, YAKNI KETIKA MENJELASKAN CABANG-CABANG ILMU APA SAJA YANG TERMASUK DALAM ILMU PENGETAHUAN HUKUM.
slide24
KonsepsiBellefroidtentangbidang-bidangIlmuHukumsebagaiberikut :

1. ILMU HUKUM DOGMATIK/DOGMATIK HUKUM  menggambarkanisidarihukum yang ada, menerangkanartidariketentuan-ketentuanhukumdanmenyusunperaturan-peraturanhukummenurutasasnyadalamsistemhukum. Pendapatparapenulismengenaihalinimerupakansuatuajaranataudoktrinyaituajaran yang berlakukalaupendapat-pendapatmerekabersesuaiansatusama lain. Dalamdogmatikhukum, bagian-bagiandarihukumdibicarakansecarakhususdenganmengikutipembedaanhukumdalamhukumperdata, hukumdagang, hukumtatanegara, hukumpidanadan lain-lain.

slide25
2. SEJARAH HUKUM  dalampandangankeilmuan, mempelajaristelsel-stelselhukummasalalu, yang membantuterbentuknyahukum yang ada. Sejarahhukuminisangatdiperlukanuntukdapatmengartikandenganbaikhukum yang berlakusekarang. Karenadalamsejarahhukumkitamengikutijalanperkembangandarilembaga-lembagahukum yang diambilolehhukum yang adasekaranginidaristelsel-stelselhukummasalalu.
slide26
3. PERBANDINGAN HUKUM  memperbanding- kan hukum-hukum yang berlaku dalam berbagai negara dan mencari peraturan-peraturan yang sama dan perbedaan-perbedaannya. Ia dapat menjadi sebab dan biasanya menyebabkan diambil opernya peraturan-peraturan dari hukum asing. Selain dari itu, perbandingan hukum menunjuk asas-asas hukum yang sama dalam berbagai macam tertib hukum dan oleh sebab itu, dijadikan dasar dari hukum internasional.
slide27
4. AJARAN HUKUM  tidak menyelidiki suatu tertib hukum tertentu, tetapi menijau hukum itu sendiri, lepas dari kekhususan waktu dan tempat. Ia mencoba menetapkan pengertian-pengertian dasar yang menjadi pangkalan dari tiap-tiap tertib hukum, diantaranya ialah pengertian hukum, kewajiban hukum, pribadi, kecakapan bertindak, objek hukum, hubungan hukum. Dengan tidak adanya pengertian dasar ini makan hukum dan ilmu hukum tidak mungkin ada.
slide28
5. POLITIK HUKUM  menyelidiki perubahan-perubahan apakah yang harus diadakan pada hukum yang ada sekarang, supaya dapat memenuhi syarat-syarat baru dari hidup kemasyarakatan. Ia melanjutkan perkembangan tertib hukum.
slide29
HUKUM PADA AWALNYA DIPAHAMI IDENTIK DENGAN PERATURAN PERUNDANG-UNDANGAN PERSEPSI ITU KELIRU. PERATURAN PERUNDANG-UNDANGAN LEBIH LUAS DARI UNDANG-UNDANG, UU HANYA PRODUK DPR (LEGISLATIF BERSAMA PRESIDEN) SEMENTARA PERATURAN PERUNDANG-UNDANGAN ADALAH SEMUA PRODUK BADAN PEMBUAT UU DAN PRODUK BADAN ATAU PEJABAT TATA USAHA NEGARA YANG MENGIKAT DAN BERLAKU UMUM.
slide30
MEMBEDAH KONTRUKSI POLITIK HUKUM SUATU NEGARA TIDAK CUKUP SEKEDAR MENELITI APA YANG TERTUANG DALAM TEKS-TEKS RESMI HUKUM, TETAPI JUGA HARUS MENYERTAKAN FAKTOR-FAKTOR NONHUKUM, ARTINYA PEMBENTUKAN HUKUM PADA DASARNYA TIDAK OTONOM, IA BANYAK DIPENGARUHI OLEH VISI IDIOLOGI PEMBUATNYA, POLITIK NEGARANYA, EKONOMI, SOSIAL, BUDAYA, DAN AGAMANYA. DENGAN DEMIKIAN, HUKUM LAHIR SELALU TIDAK BERADA DIRUANG HAMPA NILAI ATAU DALAM KEADAAN HUKUM KOSONG (VACUUM) – (MEMBANGUN NEGARA HUKUM YANG BERMARTABAT, HAL. 216)
slide31
MEMPELAJARI POLITIK HUKUM  DAPAT MENGETAHUI POLA TINDAK DAN POLA PIKIR MANUSIA SERTA KEPENTINGANNYA YANG DITUANGKAN DALAM BERBAGAI KEPUTUSAN  PERATURAN PERUNDANG – UNDANGAN.
kuliah 02
KULIAH 02

PERISTILAHAN POLITIK HUKUM.

slide33
PERISTILAHAN POLITIK HUKUM.ISTILAH POLITIK HUKUM TERDIRI DARI2 KATA YAITU “POLITIK” DAN “HUKUM”. ANTARA KATA POLITIK DAN HUKUM OLEH KEBANYAKAN AHLI HUKUM MEMANDANGNYA SEBAGAI DUA KATA YANG PARADOK.
  • HUKUM ADALAH SUATU HAL YANG SUDAH PASTI DAN JELAS, SEMENTARA POLITIK SUATU HAL YANG SELALU MENGANDUNG KETIDAK PASTIAN SELALU BERUBAH-UBAH MENURUT PELAKU POLITIK
slide34
IstilahpolitikhukumterjemahandaribahasaBelandayaiturechtspolitiek, terbentukdaridua kata yaiturechtsdanpolitiek. IstilahitupernahdigunakanolehBellefroid “ ”Politiek” dalambahasaBelandamengandungartibeleiddalambahasa Indonesia diterjemahkandengan ”kebijakan”. Kebijakanberartiadalahrangkaiankonsepdanasas yang menjadigarisbesardandasarrencanadalampelaksanaansuatupekerjaan , kepemimpinandancarabertindak. Misalnyakebijakanpenanganankorupsi, kebijakanperadilansatuatap, kebijakanperekonomianKabinet Indonesia Bersatudan lain-lain.
slide35
PolitikHukumdalambahasaInggrisdisebut Legal Policy, istilah yang terdiridariduavariabel “Politik” dan “Hukum”. DalamkonteksiniPolitikHukumdipahamisebagaibagaimanapolitikmempengaruhihukumatausebaliknyahukummempengaruhipolitik yang kemudianmengkristal di dalampolitikhukum yang digariskanolehsuatunegara.
slide36
DalamhubungankonsepkeilmuanketikamempelajariIlmu Negara, hukumdiibaratkanrangkadalamtubuhmanusia, sedangkanpolitikdiibaratkandagingatauistilah yang digunakanMuchtarKoesoemaatmadjamaupun Sri Soemantrihukumibaratrel, sementarapolitikmerupakanlokomotifnya.

Pertanyaanapakahrangka yang mengikutidagingataudaging yang mengikutirangka, ataukahlokomotif yang mengikutirelataurel yang mengikutilokomotif.

Mana yang amandaripertanyaandiatas ?.

slide37
PENGERTIAN/DEFINISI POLITIK HUKUM.Immanuel Kant sulitmendapatkansatukesatuanpengertian/definisitentanghukum. Hal yang samajugauntukmendapatkanpengertianPolitikHukum. Para ahlimengemukakandefinisimenurutlatarbelakang, carapandangmasing-masingtentangPolitikHukum. Terdapatperbedaan, namunadapersamaan.
slide38
Pengertian politik hukum dapat dilihat dari segi tata bahasa.Dari segi Tata Bahasa (asal usul kata)Kamus bahasa Belanda  (Van der Tas) :

Politiek mengandung arti beleid. Kata beleid sendiri dalam bahasa Indonesia berarti kebijakan (policy). Dari penjelasan itu dapat diartikan politik hukum secara singkat berarti kebijakan hukum. Kebijakan dalam kamus besar bahasa Indonesia berarti serangkaian konsep dan asas yang menjadi garis besar dan dasar rencana dalam pelaksanaan suatu pekerjaan, kepemimpinan dan cara bertindak.

slide39
Dengan kata lain Politik Hukum adalah Rangkaian konsep dan asas yang menjadi garis besar dan dasar rencana dalam pelaksanaan suatu pekerjaan, kepemimpinan, dan cara bertindak dalam bidang Hukum.
slide40
Kata kebijakan (wisdom, wijsheid) dankebijaksanaan

(policy, beleid) menurutGirindroPringgodigdoduahal yang berbeda.

Kebijaksanaanadalahserangkaiantindakanataukegiatan yang direncanakandibidanghukumuntukmencapaitujuanatausasaran yang dikehendaki. Orientasinyapadapembentukandanpenegakanhukummasakini, masadepan.

Adapunkebijakanadalahtindakanataukegiatanseketika (instanddesicion) melihaturgensi/situasi yang dihadapiberupapengambilankeputusan di bidanghukum yang bersifatpengaturandankeputusantertulis/lisan yang berdasarkankewenangandiskresi (kewenanganbebasbertindakjikahukumnyatidakjelas/belumada).

slide41
Sekalipun kedua istilah itu secara konseptual berbeda, namun dalam praktek sehari-hari sering penggunaanya dalam pengertian yang sama yakni rangkaian konsep dan asas yang menjadi garis besar dan dasar rencana dalam pelaksanaan suatu pekerjaan, kepemimpinan dan cara bertindak.
slide42
Menurutparapakar : • Mahfud MD.  PolitikHukumadalah “legal policy ataugaris (kebijakan) resmitentanghukum yang akandiberlakukanbaikpembuatanhukumbarumaupundenganpenggantianhukum lama, dalamrangkamencapaitujuannegara”.

Dengandemikianpolitikhukummerupakanpilihantentanghukum-hukum yang kandiberlakukansekaliguspilihantentanghukum-hukum yang akandicabutatautidakdiberlakukan yang kesemuanyadimaksudkanuntukmencapaitujuannegaraseperti yang tercantum di dalamPembukaan UUD 1945,

slide43
PadmoWahjono PolitikHukum : kebijakandasar yang menentukanarah, bentuk, maupunisihukum yang akandibentuk

ATAU :

PolitikHukum  kebijakanpenyelenggaranegaratentangapa yang dijadikankriteriauntukmenghukumkansesuatu yang didalamnyamencakuppembentukan, penerapan, danpenegakkanhukum.

slide44
Teuku Mohammad Radhie PolitikHukumsebagaisuatupernyataankehendakpenguasanegaramengenaihukum yang berlaku di wilayahnyadanmengenaiarahperkembanganhukum yang dibangun.
slide45
SatjiptoRahardjo PolitikHukumsebgiaktivitasmemilihdancara yang hendakdipakaiuntukmencapaisuatutujuansosialdenganhukumtertentu di dalammasyarakat, yang cakupannyameliputijawabanatasbeberapapertanyaanmendasar, yaitu :
slide46
1) tujuanapa yang hendakdicapaimelaluisistem yang ada.2) cara-caraapadan yang manadirasa paling baikuntukdipakaidalammencapaitujuantersebut.3) kapanwaktunyadanmelaluicarabagaimanahukumituperludiubah.4) dapatkahsuatupola yang bakudanmapandirumuskanuntukmembantudalammemutuskan proses pemilihantujuansertacara-carauntukmencapaitujuantersebutdenganbaik.
slide47
Soedarto PolitikHukumadalahkebijakannegaramelaluibadan-badannegara yang berwenanguntukmenetapkanperaturan-peraturan yang dikehendaki yang diperkirakanakandipergunakanuntukmengekspresikanapa yang terkandungdalammasyarakatdanuntukmencapaiapa yang dicita-citakan.

(bahwapolitikhukummerupakanupayauntukmewujudkanperaturan-peraturan yang baiksesuaidengankeadaandansituasipadawaktutertentu).

slide48
Bernard L. Tanya  Tidaklahkeliru, jikadikatakanbahwaPolitikHukum, hadir di titikperjumpaanantararealismehidupdengantuntutanidealisme. PolitikHukumberbicaratentang “apa yang seharusnya”, yang tidakselamanyaidentikdengan “apa yang ada”. What ought terhadap what is. PolitikHukumtidakbersifatpasifterhadap “apa yang ada”, melainkanaktifmencarai “apa yang seharusnya”.

Dengan kata lain, PolitikHukumtidakbolehterikatpada “apa yang ada”, tetapiharusmencarijalankeluarkepada “apa yang seharusnya”. Olehkarenaitu, keberadaanpolitikhukumditandaiolehtuntutanuntukmemilihdanmengambiltindakkan.

slide49
Dari definisi yang dikemukakandiatas, sebetulnyadapatditarikunsur-unsurdariPolitikHukumyakni:a. Kehendakpenguasanegaramengenaihukumb. Kehendaktersebuttelahdituangkan/digariskandalamdokumenkenegaraanc. Hal itudijadikanpedoman/arahuntukdijalankansecaranasionald. Inimenyangkutpembentukandanpenegakanhukum.
slide50
Kesimpulan:

PolitikHukumadalahkebijakandasarpenyelenggaraannegaradalambidanghukum yang akan, sedangdantelahberlaku, bersumberdarinilai-nilai yang berlakudalammasyarakatuntukmencapaitujuannegara yang dicita-citakan.

slide51
Dilihat dari sistematika perkembangan hukum dibedakan atas hukum Privat dan hukum Publik.

Hukum Privat mengatur hubungan hukum yang berkenaan dengan kepentingan perorangan.

Sedangkan hukum publik mengatur hubungan hukum yang berkenaan dengan kepentingan publik

(orang banyak).

Di antara hukum publik adalah hukum Tata Negara yakni yang mempelajari ketatanegaraan suatu negara (konstitusinya) makanya disebut dengan hukum konstitusi.Kenapa Politik Hukum merupakan Kajian Hukum Tata Negara ?

slide52
Dilihat dari Pengertian Politik Hukum.Politik Hukum sebagai kebijakan dasar penyelenggaraan negara dalam bidang hukum yang akan, sedang dan telah berlaku, yang bersumber dari nilai-nilai yang berlaku dalam masyarakat untuk mencapai tujuan negara yang dicita-citakan. Dalam definisi itu terdapat kata “penyelenggara negara” dan “tujuan negara” yang menjadi aspek kajian Hukum Tata Negara. Penyelenggara negara disebut dengan pemerintah (government) bisa diartikan dalam arti luas mencakup semua kekuasaan dan fungsi kenegaraan (eksekutif, legislatif dan yudikatif)
slide53
Fungsimanadiperankanolehkembaga-lembaganegaradanlembaga-lembagapemerintah.Tujuan Negara sebagaimanadirumuskandalampembukaan UUD Negara Republik Indonesia tahun 1945 yaitumelindungisegenapbangsa Indonesia danseluruhtumpahdarah Indonesia, memajukankesejahteraanumum, mencerdaskankehidupanbangsadanikutmelaksanakanketertibandunia.

Tujuanitutidakmungkindicapaidenganmudah, tetapiperlustrategi/kebijakan.

slide54
Politik Hukum NasionalPolitik hukum nasional yang dimaksud adalah kebijakan dasar penyelenggaraan negara dalam bidang hukum yakni hukum yang akan, sedang dan telah dijalankan, yang bersumber dari nilai-nilai yang berlaku dalam masyarakat untuk mencapai tujuan negara yang dicita-citakan. Setiap negara memiliki politik hukum nasional masing-masing, karena itu politik hukum nasional dibentuk dalam rangka untuk mewujudkan cita-cita ideal negara.
slide55
Bagi Indonesia tujuan politik hukum adalah:(1) Sebagai alat (tool) atau sarana yang dapat digunakan oleh pemerintah untuk menciptakan suatu sistem hukum nasional Indonesia. (2) Sebagai sarana untuk merekayasa perkembangan, perubahan yang terjadi dalam kehidupan kenegaraan.(3) Arah yang ingin diwujudkan dalam pembangunan di bidang hukum.
slide56
HukumNasional Indonesia bersumberpadaPancasiladan UUD Negara RI tahun 1945 menurutSunaryati Hartono (guru besarUnpad, mantankepala BPHN) dapatberisihukumnasional yang telahditetapkan, hukumbarat, hukumadatdanhukum Islam. AriefSidarta (guru besarfilsafatUnpad) berpendapattatananhukumnasionalharusmengandungciri-ciri:
slide57
a. berwawasankebangsaandanberwawasannusantara.b. mampumengakomodirkesadaranhukumkelompoketniskedaerahandankeyakinankeagamaanc. Sedapatmungkintertulisdanterunifikasid. Bersifatnasional yang mencakuprationalitasefisiensi, rationalitaskewajaran, rationalitaskaedah, rationalitasnilai.e. Aturanprosedural yang menjamintransparansi yang memungkinkankajian rational terhadapprosespengambilankeputusanolehpemerintahf. Responsifterhadapperkembanganaspirasidanekspektasimasyarakat.
slide58
- Keberhasilansuatuperaturanperundang-undangantergantungpadapenerapannya. Apabilapenegakanhukumtidakdapatberfungsidenganbaikperaturanperundang-undangan yang bagaimanapunsempurnanyatidakataukurangmemberikanartisesuaidengantujuan.- Putusandalamrangkapenegakkanhukummerupakaninstrumenkontrolbagiketepatandankekurangansuatuperaturanperundang-undangan
slide59
POLITIK HUKUM JUGA SUATU UPAYA UNTUK MEMILIH DAN MENGARAHKAN HUKUM YANG SESUAI DENGAN KEBUTUHAN MASYARAKAT YANG BERSIFAT :
  • FASILITATIF.
  • AKOMODATIF.
  • ADAPTIF.
  • BOTTOM UP.
  • FUTURISTIK.
slide60
Fasilitatif – yaitu hukum yang dapat memfasilitasi berbagai kepentingan masyarakat, artinya segala hal yang dibutuhkan oleh masyarakat hukum telah memberikan jalannya.
slide61
Akomodatif - yaitu hukum yang dapat mengakomodasikan berbagai kepentingan masyarakat, artinya apa yang dibutuhkan oleh masyarakat hukum telah memberikan jalannya.
slide62
Adaptif - yaitu hukum yang dapat beradaptasi dengan hal-hal yang baru terjadi dengan tetap memberikan kepastian hukum, dan tetap dengan memberikan perhatian terhadap hukum yang lama, sehingga dalam hal ini hukum harus dapat mengintegrasikan berbagai nilai lama dan hal-hal yang baru, sehingga jika terjadi perubahan tidak menimbulkan gejolak yang mengakibatkan kekosongan hukum.
slide63
Bottom up - bahwa hukum merupakan kristalisasi berbagai nilai yang hidup dalam masyarakat selama ini, artinya nilai-nilai yang selama ini hidup dalam masyarakat dan nilai-nilai tersebut diyakini sebagai sesuatu yang benar, maka harus dihargai dan dinormatifkan dalam bentuk suatu peraturan perundang-undangan.
slide64
Futuristik - yaitu hukum yang dapat mengantisipasi berbagai kejadian yang mungkin muncul pada suatu hari. Meskipun suatu tindakan hukum tidak diaturdalam peraturan perundang-undangan, tapi hukum yang futuristik telah memberikan jalan keluarnya.
kuliah 03
KULIAH 03

DASAR PIJAKAN POLITIK HUKUM DAN POLITIK HUKUM DALAM BERBAGAI TEORI

  • (Bernard L. Tanya, Politik Hukum, Agenda Kepentingan Bersama,Genta Publishing, Yogyakarta, 2011)
slide66
66
  • BASIS IDEOLOGIS.

Ideologi  sebagai perangkat nilai – tidak lain dari nilai-nilai, konsep-konsep, dan gagasan-gagasan melalui mana dan dengan cara apa sekelompok manusia memahami diri mereka dan dunia di mana mereka hidup.

slide67
Sebuah Ideologi adalah sesuatu yang apriori sifatnya. Ia berupa visi dan cita-cita. Dan karena merupakan visi dan cita-cita, maka ia bersifat NORMATIF sekaligus KONSTITUF.

NORMATIF berfungsi sebagai prasyarat transedental yang mendasari tiap keputusan atau kebijakan. Menjadi landasan dan sekaligus tolok ukur segala tindakkan.

KONSTITUTIF  berfungsi mengarahkan segala kebijakan pada tujuan yang ingin dicapai.

slide68
Ideologi berfungsi sebagai GUIDING PRINCIPLE, norma kritik, dan nilai yang memotivasi tiap tindakkan dan pilihan yang akan diambil.

Perbedaan klaim nilai-nilai yang dianggap sentral dan hakiki (ideologi) di balik tiap sistem, memunculkan perbedaan, tidak saja tataran isi norma hukum, tetapi juga pada kontent asas, tujuan dari suatu sistem hukum.

68

slide69
69

B.BASIS NORMATIF.

Politik Hukum berbicara tentang “apa yang seharusnya”  what ought terhadap what is. Politik Hukum bertugas menilai kenyataan sekaligus merubahnya ke arah yang benar, baik dan adil. Oleh karena itu butuh kerangka Normatif tentang apa yang benar, apa yang baik, dan apa yang adil – yang mesti diperjuangkan dan diwujudkan.

slide70
Menurut ahli filsafat dalam kerangka normatif yang disebut benar, baik dan adil, antara lain :

Immanuel Kant ada 2 (dua) patokan yang benar :

Pertama – Benar, jika apa yang kita lakukan itu dapat berlaku sebagai hukum yang bersifat universal  apa yang kita lakukan itu benar, apabila dimanapun dan kapanpun adalah yang seharusnya dilakukan siapapun.

70

slide71
Kedua – benar, apabila kita memperlakukan manusia ) orang lain atau diri kita sendiri), di dalam setiap hal, sebagai tujuan, dan bukan sekedar alat  suatu tindakkan itu pasti salah, apabila ia memperlakukan manusia sebagai obyek, bukan subyek yang penuh sebagai manusia.

Bertindak menurut hukum, prinsip, norma obyektif adalah benar. Menaati prinsip berarti benar. Melanggar prinsip, berarti salah.

71

slide72
Thomas Aquinas ada 3 (tiga) kategori keadilan :

Pertama – ius distributiva (keadilan distributif), yang menunjuk pada prinsip “kepada yang sama diberikan yang sama, kepada yang tidak sama diberikan yang tidak sama pula  Kesederajatan Geometris.

72

slide73
Kedua – iustita commutativa (keadilan komutatif), menujuk pada keadilan berdasarkan prinsip aritmetis, yaitu penyesuain yang harus dilakukan apabila terjadi perbuatan yang tidak sesuai dengan hukum.

73

slide75
C. BASIS KONSTITUSIONAL.

Fokus Konstitusi  hakikatnya sebagai hukum dasar, yang di satu pihak mengatur dan membatasi kekuasaan, dan di lain pihak serentak menjamin hak dan kepentingan warga negara/rakyat. Dalam konstitusi pula, secara teoritis, memuat tujuan-tujuan bersama yang hendak dicapai dalam kehidupan berbangsa, bernegara, dan bermasyarakat,

75

slide76
Konstitusi merupakan hukum tertinggi yang menjadi titik tolak dan batu uji semua produk hukum di bawahnya.

Sesuai prinsip STUFENBAU (HANS KELSEN)  Konstitusi menjadi dasar justifikasi validitas peraturan perundang-undangan di bawahnya. Untuk disebut hukum yang valid, maka peraturan perundang-undangan tidak boleh bertentangan dengan konstitusi.

76

slide77
77

Hakikat Konstitusi sebagai :

  • Kumpulan kaidah tentang pembatasan kekuasaan negara terhadap rakyat.
  • Dokumen tentang pembagian tugas dari lembaga-lembaga negara.
  • Deskripsi kerangka kerja bagi lembaga-lembaga negara.
  • Penegasan HAM rakyat yang diperintah.
slide78
D. BASIS MORAL

Politik Hukum memerlukan basis moral, karena kebijakan yang mutu dan berorientasi pada perubahan bagi kepentingan orang banyak, hanya bisa lahir dari lembaga/pengambil keputusan yang memiliki tingkat kesadaran moral yang mumpuni,

78

slide79
79

Bahwa basis moral yang dibutuhkan dalam pengelolaan politik hukum adalah “moralitas taat asas”, “moralitas akal kritis” dan “moralitas hati nurani”.

slide80
Politik Hukum dalam Ajaran Plato

Plato  hukum sebagai sarana keadilan.

The Philosopher Kings sebagai pemimpin negara. Karena mereka adalah orang-orang pilihan – kaum arif bijaksana, maka di bawah pemerintahan dimungkinkan adanya partisipasi semua orang dalam gagasan keadilan. Bahwa tanpa hukumpun, keadilan bisa dimungkinkan tercipta, sebab kaum arif bijaksana ini pasti mewujudkan THEORIA (pengetahuan dan kebijaksanaan terbaiknya) dalam tindakkan.

80

slide81
Kaum arif tidak saja memerintah secara bijaksana dan adil, melainkan juga menjadi guru moral bagi warganya. Dalam negara yang dipimpin para guru moral inilah, maka manusianya yang menjadi warganya dimungkinkan mencapai kesempurnaan jiwa, dalam arti menjadi pelaku dan serentak penikmat keadilan.

81

slide82
Tapi ketika negara tidak lagi dipimpin oleh mereka kaum arif dan bijaksana, sehingga tidak mungkin adanya partisipasi semua orang dalam keadilan. Di sinilah Plato mengusulkan pentingnya hukum. Hukum dibutuhkan sebagai sarana keadilan. Sarana keadilan melawan ketidakadilan penguasa yang serakah, korup dan kesewenang-wenangan.

82

slide83
Untuk memastikan tercapainya tujuan tersebut, maka hukum yang membawa misi keadilan itu, haruslah :

PERTAMA  aturan-aturan hukum mesti dihimpun dalam satu kitab, supaya tidak kekacauan hukum.

KEDUA  setiap undang-undang harus didahului Preambule tentang motif dan tujuan undang-undang tsb. Manfaatnya agar setiap orang dapat mengetahui dan memahami kegunaan dan menaati hukum tersebut.

83

slide84
KETIGA  tugas hukum adalah membimbing para warga negara pada suatu hidup yang saleh dan sempurna.

KEEMPAT  orang yang melanggar undang-undang harus dihukum. Tapi hukuman tersebut bukan balas dendam, melainkan memperbaiki sikap moral si penjahat.

84

slide85
2. Politik Hukum dalam Ajaran Agustinus

Ajaran Agustinus  nilai-nilai deligere (dihargai dan dicintai) dan delicto proximi (mengasihi sesama). Kedua nilai tersebut sebagai bagian dari keadilan.

85

slide86
Idealisme Agustinus tentang “komunitas cinta kasih” sebagai jalan menuju tercapainya hidup bersama yang damai. Komunitas ini merupakan agenda untuk melawan rezim regnum – yang menunjuk pada kerajaan Romawi – sebagai segerombolan perampok karena tidak memiliki keadilan.

Tujuan akhir dari perjuangan ini  terwujudnya “masyarakat cinta kasih” sebagai jalan menuju tercapainya hidup bersama yang damai.

86

slide87
3. Politik Hukum dalam Ajaran Aquinas.

Ada 2 (dua) ajaran Aquinas berkaitan dengan Politik Hukum :

Usahanya melawan sistem hukum yang melegalkan faham patrimonial dalam kekuasaan berdasarkan hak milik perdata (every man must have a lord).

Hukum merupakan produk akal sehat, bukan kehendak yang arbitrer. Distingsi ini penting dalam rangka mencegah penyusupan kepentingan selera, dan nafsu para pembuat dan pelaksana hukum ke dalam ruang hukum. Peluang penyusupan ini terbuka lebar mengingat hukum merupakan produk politik, dan pelaksanaannya pun dijalankan oleh lembaga kekuasaan.

87

slide88
3. Karena hukum ditujukan bagi kebaikan dan kesejahteraan umum, maka isi pelaksanaannya harus dapat diterima akal sehat semua orang.

4. Hukum perlu dipublikasikan karena ia mengandung aturan yang memandu hidup manusia, maka aturan itu mesti mereka ketahui agar memiliki nilai kewajiban.

slide89
Teori Aquinas tentang hukum :

Hukum dan perundang-undangan harus rasional dan masuk akal karena ia merupakan aturan dan ukuran tindakkan manusia.

Hukum ditujukan bagi kebaikan umum. Karena hukum merupakan aturan bagi perilaku, dan karena tujuan dari segala perilaku itu adalah kebahagiaan, maka hukum mesti ditujukan bagi kebaikan bersama.

89

slide90
4. PolitikHukumdalamAjaran

Thomas Hobbes

PolitikHukumdalamajaran Thomas Hobbes  terletakpadaupayateoritisnyamencegahkonflik total dalammasyarakat  kecenderunganalamiahmanusiamementingkanegonya. Dalamgambaran Hobbes, manusiasejakzamanpurbakaladikuasaiolehnafsu-nafsualamiah, dantidak care padasoal-soalkeadilan, karenanyabayang-bayang bellum omnium contra omnesselalumenghantuimereka.

slide91
Menghadapi realitas yang demikian, hukum harus mengambil peran menentukan, terutama untuk menjamin keamanan tiap individu dalam masyarakat. Jaminan keamanan dimaksud, merupakan kebutuhan bersama dari tiap individu, sehingga melalui kontrak sosial, mereka bersedia menyerahkan kebebasannya kepada penguasa untuk mengatur kehidupan bersama yang damai.

91

slide92
Menurut Hobbes, hukumlah yang merupakan instrumen paling pokok untuk mencapai tujuan bersama yang damai. Dalam dimensi Politik Hukum, maka hukum ditugaskan mengemban misi mulia dan khusus untuk mewujudkan common goal masyarakat, yakni hidup damai, dan tidak saling memangsa (homo homoni lupus).
slide93
Untukmencapaihidup yang damaitsb, harusdapatdipastikanbahwahukumbenar-benarberfungsiefektifmelindungikeamananindividu-individuwargamasyarakat. Agar hukumberfungsiefektif, makadibutuhkanpemerintahdengankekuasaanbesaruntukmenjalankanhukumtsb, tanpaadakekuasaanpemerintah yang efektifdankuat, makatiaporangakanmengandalkankekuatannyasendiri.
slide94
Menurut Hobbes  tanpa kekuasaan yang efektif, maka hukum dan keadilan sama-sama tidak memiliki makna. Di mana tidak ada kekuasaan, di situ tidak ada hukum. Dan di mana tidak ada hukum, di situ tidak ada keadilan.

94

slide95
5. Politik Hukum dalam Ajaran John Locke

John Locke  pada usahanya untuk melindungi hak-hak alamiah manusia, yaitu : hak hidup, kebebasan dan hak milik. Ketiga hak ini menyangkut eksistensi hakiki manusia, maka tidak boleh diganggu gugat, apalagi dihapuskan.

95

slide96
Menurut Locke  negara wajib menghormati dan serentak menjaga hak-hak tersebut agar tidak terciderai. Instrumen yang paling efektif untuk mengawal dan menjaga kelestarian hak-hak dimaksud, adalah hukum. Negarapun harus tunduk pada hukum yang melindungi hak-hak alamiah tsb. Maka parlemenlah yang harus membuat hukum, khususnya aturan yang menyangkut tiga hak tsb. Hak rakyat (lewat parlemen) menyusun undang-undang adalah bersifat primer, asli dan tidak bisa dicabut.

96

slide97
97

Jadisistemhukum yang dibutuhkanuntukmenjaminhak-hakalamiahtsb, adalahSistemHukumKodifikasi yang dibuatparlemen yang berisipelestarianmasyarakatdanpelestariantiapanggotamasyarakat, melarangmenghancurkanhidupnya, danmelarangmerampashidupdankekayaan orang lain.

slide98
Menurut Locke  prinsip posisi rakyat/parlemen dalam fungsi legislasi  produk undang-undang yang dihasilkan parlemen pun tidak dapat diganggu gugat  asas undang-undang tidak dapat diganggu gugat.

Yudikatif hanya bertugas menjalankan saja apa yang dirumuskan dalam undang-undang  la bouche de la lois (hakim merupakan mulut undang-undang) dan hakim harus menuruti secara harfiah apa kata undang-undang (les juges suivent la lettre de lois)

slide99
6. PolitikHukumdalam

Ajaran Montesquieu

Montesquieu  dimensipolitikhukumuntukmenjaminhakdankebebasanpolitikwarganegara, yaituhakwarganegarauntukmelakukanapapun yang diperbolehkanolehhukum, danhakwarganegaramemperoleh rasa aman.

slide100
100

Dalamhalinitugashukumadalahmenjagadanmengawalhak-haktersebut. Untukmemastikanbahwahak-hakituaman, makaharusdihindaripemusatankekuasaandalamnegara. Kekuasaanmembuathukum (LEGISLATIF) tidakbolehberada di satutangandengankekuasaan yang melaksanakanhukum (EKSEKUTIF) maupundengankekuasaan yang mengadili (YUDIKATIF). Fungsipemisahantsbdilakukan agar terjadichek and balances.

slide101
Dalamgagasan TRIAS POLITICA  rakyatdiposisikansebagaipemegangkekuasaannegara. Dan melaluiparlemendengankekuasaanlegislasinya, kepentinganrakyatdapatterwakilisecarabaik. JadipemisahankekuasaandalamTriasPolitica demi memperolehkepastianbahwakebebasanwarganegaratidakdiciderai.

Montesquie  pemisahankekuasaan yang ketat di antaratigakekuasaantsb, merupakanprasyaratkebebasanpolitikbagiwarganegara.

101

slide102
7. PolitikHukumdalamAjaran Karl Marx

Dalamgagasan Karl Marx  menghilangkanstruktur yang menindasdalamhubunganekonomi (ketimpanganekonomi). Perjuangan Marx untukmenghilangkanstruktur yang menindastsb (termasukpenindasan yang terselubungdalamhukum), merupakanproyekpolitikhukum.

slide103
Menurut Marx  keadaan yang penuh penindasan dan penghisapan harus dihapus. Maka negara dan hukum dipakai sebagai alat perjuangan demi terciptanya masyarakat egaliter. Dalam masyarakat egaliter, tidak ada ada lagi eksploitasi, karena semua diatur bersama. Tidak ada lagi pemilikan modal (alat produksi) secara pribadi, baik oleh individu maupun kelompok. Modal dimiliki secara kolektif oleh semua anggota masyarakat.

103

slide104
Untuk mewujudkan hal tersebut  hukum yang dikendalikan oleh diktator proletariat dibutuhkan untuk membantu kaum buruh merealisasi sejarah, yakni masyarakat sosialis sempurna. Hukum itu harus dipegang oleh diktator proletariat supaya bisa cepat dan efektif melaksanakan misi proletariat.

104

slide105
Nilai politik hukum dalam pemikiran Marx  pada agenda kritiknya, yakni menggunakan hukum untuk mengadakan perubahan menuju yang lebih baik (tapi bukan pada revolusi proletariatnya)  melainkan pada penggunaan hukum untuk memperbaiki keadaan demi kepentingan umum.

105

slide106
8. Politik Hukum dalam

Teori Henry Maine

Movement from Status to Contract  secara implisit memiliki implikasi pada politik hukum  bahwa tingkat perkembangan masyarakat menentukan tipe hukum yang dibutuhkan untuk melayani masyarakat tersebut.

106

slide107
Menurut Maine  dalam masyarakat tradisional yang beruanglingkup sempit dan lokal (static societis), di mana anggota-anggotanya terstratifikasi dalam lapisan-lapisan sosial yang serba berjenjang menurut status, maka hukum hanya bertugas meneguhkan hubungan-hubungan antar status. Di sini hak dan kewajiban dibagi-bagi secara berbeda (diskriminatif) menurut kriteria “status bawaan” masing-masing.
slide108
108

Persoalanmenjadi lain samasekali, manakalastruktur-struktur status yang bersifatfeodalmulailuntur, berkaitandenganmeningkatnyainterdependensiantarasegmen-segmensosialdalamkehidupanekonomi (progressive societis). Di sinihubungan-hubungan yang berbasisprestasi, keahlian, dankompetensimenjadilebihmenonjol. Manusiatidaklagidilihatdarisegi “bawaannya” atau “status’nya, tapidariprestasi yang dibuatnya. Prestasiharusdibalaskontraprestasi.

slide109
109

Teori Maine  mendorong adanya politik hukum tertentu yang kondusif untuk menangani masalah-masalah khas dalam suatu masyarakat sesuai tingkat pertrumbuhannya. Jika yang diinginkan adalah sebuah masyarakat yang maju, modern, produktif dan efisien, maka dibutuhkan hukum yang lebih objektif dan rasional – demi memudahkan hubungan-hubungan kontraktual yang berbasis kebutuhan masyarakat modern.

slide110
110

Politik hukum harus mengarahkan dan mengerahkan seluruh sumber daya yang dimiliki untuk menopang kebutuhan dan tujuan masyarakat tersebut, bukan sebaliknya mengijinkan perangkat-perangkat hukum yang justru menghambat kebutuhan dan tujuan masyarakat yang bersangkutan.

slide111
9. Politik Hukum dalam Teori

Gustav Radbruch

Menurut Gustav Radbruch  keadilan sebagai CORE dari tata hukum.

Hukum sebagai pengemban nilai keadilan, menjadi ukuran bagi adil dan tidak adilnya tata hukum. Tidak hanya itu, nilai keadilan juga menjadi dasar dari hukum sebagai hukum. Dengan demikian, keadilan memiliki sifat normatif sekaligus konstitutif hukum. Ia normatif, karena berfungsi sebagai prasyarat transedental yang mendasari tiap hukum positif yang bermartabat.

111

slide112
Dalam konteks Politik Hukum Radbruch  keadilan merupakan titik sentral dlam hukum.

Adapun dua aspek lainnya  KEPASTIAN dan FINALITA/KEMANFAATAN, bukanlah unit yang berdiri sendiri dan terpisah dari keadilan.

Kepastian dan Kemanfaatan harus diletakan dalam kerangka keadilan itu sendiri. Sebab tujuan keadilan adalah untuk memajukan kebaikan dalam hidup manusia.

112

slide113
Bagi Radbruch  fungsi kepastian hukum, tiada lain adalah memastikan bahwa hukum (yang berisi keadilan dan norma-norma yang memajukan kebaikan manusia), benar-benar berfungsi sebagai peraturan yang ditaati. Dengan adanya kepastian hukum bahwa aturan-aturan itu ditaati, maka keadilan benar-benar mendatangkan manfaat bagi kebaikan manusia, baik sebagai individu maupun sebagai komunitas.

113

slide114
10. Politik Hukum dalam

Teori Talcott Parsons.

Menurut Parsons  peranan tatanan normatif (hukum), merupakan unsur paling teras/depan dari integrasi sebuah sistem. Ia harus menjinakkan sub-sub sistem yang lain agar bisa berjalan sinergis tanpa saling bertabrakan. Hukum memiliki tugas khusus menjamin integrasi dalam sebuah sistem atau masyarakat.

114

slide115
Dalam pandangan Parsons  sebuah sistem (keluarga, masyarakat, taupun negara), selalu terdiri dari 4 subsistem,

yaitu : subsistem budaya/nilai-nilai, subsistem norma/hukum, subsistem politik/otoritas dan subsistem ekonomi. Untuk menjaga berjalannya keempat subsistem tersebut  hukum ditugaskan menata keserasian dan gerak sinergis dari tiga subsistem yang lainnya  hukum sebagai sarana integrasi

115

slide116
Mengapa posisi hukum begitu penting dalam menjalankan fungsi integrasinya ? Menurut Parsons  tiap-tiap subsistem memiliki logika, mekanisme, dan tujuan yang berbeda. Di satu sisi, subsistem budaya cenderung konservatif dan setia mempertahankan pola-pola ideal.Pada sisi yang lain, subsistem ekonomi sangat dinamis dan cenderung melahirkan terobosan-terobosan baru yang bisa saja asing dan liar dari ukuran pola-pola ideal budaya, Sedangkan subsistem politik senantiasa mencari berbagai cara untuk mencapai tujuan – yang boleh jadi cara-cara yang dipakai tidak sesuai dengan pola budaya dan realitas sumberdaya materil.

116

slide117
11. Politik Hukum dalam Teori Bredemeir.

Terletak  pada peran pengadilan dalam melahirkan putusan-putusan yang berbobot bagi terjaminnya integrasi sistem  bahwa fungsi hukum adalah untuk menyelesaikan konflik-konflik yang timbul dalam masyarakat.

117

slide118
Kedudukanhukumsebagaisuatuinstitusi yang melakukanpengintegrasianterhadap proses-proses yang berlangsungdalammasyarakat, menyebabkanhukumharusterbukamenerimamasukan-masukandaribidangekonomi, politikdanbudaya, untukkemudiandiolahmenjadikeluaran-keluaran yang produktifdanberdayaguna.

118

slide119
JadiletakPolitikHukumdalamteoriBredenmeir padakeharusanputusan-putusanpengadilan yang harusmenyumbangmanfaatbagi sub-subsistem yang lain, baikuntuksubsistempolitik, budaya, maupunekonomi. Tujuanakhirnyaadalah, menjaminintegrasidankelangsunganhidupsistem.

119

slide120
12.Politik HukumdalamTeori

Roscoe Pound

Menurut Pound  hukumtidakbolehdibiarkanmengawangdalamkonsep-konseplogis-analitisatautenggelamdalamungkapan-ungkapanteknisyuridis yang terlampaueksklusif. Sebaliknyahukumitumestididaratkan di dunianyata, yaituduniasosial yang penuhesakdengankebutuhandankepentingan-kepentingan yang salingbersaing.

120

slide121
Fokusutama Pound dengnkonsep social engineering adalah interest balancing, dankarenanya yang terpentingadalahtujuanakhirdarihukum yang diaplikasikandanmengarahkanmasyarakatkearah yang lebihmaju.

121

slide122
Dengan kata lain, hukum sebagai sarana social engineering (law as tool of social engineering), tertuju pada penggunaan hukum secara sadar untuk mencapai tertib atau keadaan masyarakat sebagaimana dicita-citakan. Hukum tidak lagi dilihat sekedar sebagai tatanan penjaga status quo, tetapi diyakini sebagai sistem pengaturan untuk mencapai tujuan-tujuan tertentu secara terencana, yakni terciptanya masyarakat beradab yang produktif, minim konflik, dan tidak boros.

122

slide123
11. Politik Hukum dalam

Teori Nonet – Selznick.

Proposal Nonet – Selznick  Hukum Responsif, Hukum Represif dan Hukum Otonom.

123

slide124
Nonet – Selznick menolaktipehukumrepresifdanhukumotonom.

Hukumrepresifditolakkarenamenjadialatkekuasaan, danmelayanikepentingankekuasaan, bukanmelayanikeadilanbagimasyarakat. Hukumrepresifdiperalatpenguasauntukmenindasdanmenekanrakyat.

124

slide125
Hukumotonomjugaditolak, karenacenderunglebihmementingkanotonomiinternalnyadaripadakebutuhansosial yang berhimpit-himpit yang mestinyadilayaniolehhukum.

BagiNonet – Selznick dibalikdoktrinotonomihukum, tersembunyiideologi Status quo. Dan status quo merupakanbentengperlindungan (Canopy) orang-orang mapan/berpunya. Keberpihakanhukumsangatjelas. Iamenguntungkangolongan kaya danmerugikansertamenipugolonganmiskin.

125

slide126
Dalam makna tsb. Isolasi sistem hukum dari berbagai institusi sosial di sekitarnya, justru berdampat buruk dari sisi kebutuhan manuia itu sendiri. Hukum dengan mudah berubah menjadi institusi yang melayani diri sendiri, bukan lagi melayani manusia, Hukum tidak bisa lagi diandalkan sebagai alat perubahan dan sebagal alat untuk mencapai keadilan substantif.

Hukum bukanlah tujuan pada dirinya sendiri. Hukum adalah alat bagi manusia. Ia merupakan instrumen untuk melayani kebutuhan manusia.

126

slide127
Secara tersembunyi institusi-institusi hukum telah tercemar dan ikut menyebabkan ketiadaan ketertiban sosial secara keseluruhan. Hukum bekerja sebagai alat kekuasaan. Bukan keadilan sosial yang diraih dalam otonomi hukum, tapi kemenangan orang-orang yang mapan dan kaya. Pengadilan, bukan tempat orang-orang kelas bawah mendapatkan keadilan sosial, tapi menjadi mimbar dari kelas atas mengadili kelas bawah.

127

slide128
Untuk menjawab krisis atas otoritas hukum, Nonet-Selznick mengajukan model Hukum Responsif  yang menempatkan hukum sebagai sarana respons terhadap ketentuan-ketentuan sosial dan aspirasi publik.

Sesuai sifatnya yang terbuka, maka tipe hukum responsif mengedepankan akomodasi untuk menerima perubahan-perubahan sosial demi mencapai keadilan dan emansipasi publik.

128

slide129
Tatanan Hukum Responsif menekankan :

Keadilan substantif sebagai dasar legitimasi hukum.

Peraturan merupakan subordinasi dari prinsip dan kebijakan.

Pertimbangan hukum harus berorientasi pada tujuan dan akibat bagi kemaslahatan masyarakat.

Penggunaan diskresi sangat dianjurkan dalam pengambilan keputusan hukum dengan tetap berorientasi pada tujuan.

Memupuk sistem kewajiban sebagai sistem paksaan.

Moralitas kerjasama sebagai prinsip moral dalam menjalankan hukum.

Kekuasaan didayagunakan untuk mendukung vitalitas hukum dalam melayani masyarakat.

Penolkan terhadap hukum harus dilihat sebagai gugatan terhadap legitmasi hukum.

Akses partisipasi publik dibuka lebar dalam rangka integrasi advokasi hukum dan sosial.

129

slide130
GARIS POLITIK HUKUM INDONESIA

MENURUT KONSTITUSI

  • GarisPolitikHukumdalamHidupBerbangsa.

Negara melindungisegenapbangsa Indonesia danseluruhtumpahdarahindonesiadenganberdasarkanataspersatuan.

130

slide131
2. Politik Hukum dalam Hidup Bermasyarakat.

Negara hendak mewujudkan keadilan sosial bagi seluruh rakyat.

131

slide132
132

3. Politik Hukum dalam Hidup Bernegara

Negara yang berkedaulatan rakyat, berdasar kerakyatan dan permusyawaratan perwakilan

slide133
4. Politik Hukum dalam Hidup Beragama.

Negara berdasar atas Ketuhanan Yang Maha Esa menurut dasar kemanusiaan yang adil dan beradab

slide134
Moh Mahfud MD  Corak dan Karakter Produk Hukum – untuk menggambarkan mengenai pengaruh konfigurasi politik dengan produk hukum.

(Untuk mengukur konfigurasi politik dalam setiap produk hukum, apakah ia demokrasi atau otoriter dapat dilihat melalui 3 pilar demokrasi, yaitu : peranan partai politik dan DPR, peranan lembaga eksekutif, kebebasan pers/akses informasi bagi setiap warga masyarakat).

slide135
Moh. Mahfud MD ada 2 karakter produk hukum :

1. Produk hukum responsif/populistik adalah produk hukum yang mencerminkan rasa keadilan dan memenuhi harapan masyarakat. Dalam proses pembuatannya memberikan peranan besar dan partisipasi penuh kepada kelompok-kelompok sosial atau individu di dalam masyarakat. Hasilnya bersifat responsif terhadap tuntutan-tuntutan kelompok sosial atau individu dalam masyarakat. Dalam arti cirinya selalu melibatkan semua komponen masyarakat (syarat formal).

slide136
2. Produk hukum konservatif  produk hukum yang isinya (materi muatannya) lebih mencerminkan visi sosial elit politik, lebih mencerminkan keinginan pemetrintah, bersifat positivistik-instrumentalis, yakni menjadi masyarakat alat pelaksanaan ideologi dan program negara. Berlawanan dengan hukum responsif, hukum orthodoks, lebih tertutup terhadap tuntutan-tuntutan kelompok maupun individu-individu di dalam masyarakat. Dalam pembuatannya peranan dan partisipasi masyarakat relatif kecil.
kuliah 04

KULIAH 04

RuanglingkupPolitikhukumtidaklepasdarikebijakandibidang lain. Penyusunanpolitikhukumharusselaludiusahakanseiringdenganaspek-aspekkebijakandibidangekonomi, politik, sosial, budaya, teknologidansebagainya. Cakupanpolitikhukumdapatdipahamidalamduapengertianyaitu:

slide138
A. PolitikHukumsebagaiarahkebijakanpembangunanhukumsuatunegara, halinimencakupkebijakanhukum yang telah, sedangdanakandilakukanolehsuatunegara.

B. PolitikHukumdiartikansebagaihubunganpengaruhtimbalbalikantarahukumdanpolitik.

slide139
Mahfud MD  Studi Politik Hukum mencakup :

Kebijakan negara (garis resmi) tentang hukum yang akan diberlakukan atau tidak diberlakukan dalam rangka pencapaian tujuan negara.

Latar belakang politik, ekonomi, sosial budaya (poleksusbud) atas lahirnya produk hukum.

Penegakkan hukum di dalam kenyataan lapangan.

slide140
A. Adadualingkuputamaarahkebijakanpembangunanhukumsuatunegarayakni:a. PolitikPembentukanHukumb. PolitikPenegakanhukum.
slide141
a. Politikpembentukanhukumadalahkebijakan yang bersangkutandenganpenciptaan, pembaharuandanpengembanganhukum. Hal inimencakup:1. Kebijakanpembentukanperudang-undangan, kebijakanpembentukanhukumkita yang utamaadalahlewatperundang-undangan. Bagi Negara Indonesia yang mengikutisistemhukum continental undang-undangadalahsumberutamahukum. Karenaitukebijakanpembentukanperundang-undanganharusdirencanakanmelaluisuatusistemperencanaannasional yang disusundalam program legislasinasional. Lewat program legislasinasionalakantampakarahanundang-undangapa yang akandibuatdalam 20 tahun yang akandatang, 5 tahun yang akandatang, ataupun 1 tahun yang akandatang. Namun, bolehsajadalamperjalanannyaterjadiperkembangan yang cepat, apa yang telahdi program diubahberdasarkankebutuhan.
slide142
2. Kebijakan (pembentukan) hukum yurisprudensi, yurispudensi merupakan sumber hukum selain undang-undang. Pada dasarnya sistem hukum Indonesia menganut asas hakim tidak terikat pada precedent atau putusan terdahulu mengenai persoalan hukum serupa
slide143
Dalam sistem kontinental putusan pengadilan bersifat “persuasive power of the precedent”. Berbeda dengan system anglo saxon dimana hakim terikat pada precedent yang disebut dengan “Stare decisis et quit non movers” sebagai asas “the binding force of precedent”.
slide144
UU Kehakiman menganut asas ius curia novit (Pasal 16). Artinya hakim tidak boleh menolak mengadili perkara dengan alasan undang-undang tidak ada, tidak jelas, belum lengkap, tetapi wajib mengadili perkara. Untuk mengadili tersebut hakim harus tunduk pada ketentuan pasal 27 Undang –undang No. 4 tahun 2004 yang mengatakan “ hakim wajib menggali, mengikuti nilai-nilai hukum yang hidup dalam masyarakat” atau living law.
slide145
3. Kebijakan terhadap peraturan tidak tertulis lainnya merupahan hukum yang tidak tertulis yang tumbuh dan berkembang dalam kehidupan masyarakat, kebiasaan mana diperlihara dan dipertahankan dalam mengatasi persoalan yang dihadapi. Seperti dalam bidang pertanahan yang mengakui keberadaan hak ulayat. Hak ulayat mana diatur menurut sistem hukum adat yang mempunyai ciri khas tidak tertulis, namun Undang-undang Pokok Agraria mengakui hak tersebut sepanjang masih ada dan hidup dalam kenyataannya di tengah-tengah masyarakat adat tersebut.
slide146
b. Politik Penegakan Hukum mencakup:

1. Kebijakan dibidang peradilan, dalam hal ini bagaimana arah kebijakan terhadap peradilan. Misalnya sebelum amandemen UUD 1945 kebijakan terhadap peradilan dikelola melalui dualisme pembinaan. Satu sisi hakim berada dibawah pembinaan Mahkamah Agung, sisi lain hakim berada di jajaran departemen dibawah pembinaan Menteri terkait (eksekutif). Kebijakan demikian melahirkan kecurigaan dan pertanyaan, hakim tidak independen/ apakah hakim bisa mandiri dalam mengadili perkara. Setelah diamandemen kebijakan terhadap peradilan dilakukan lewat pembinaan satu atap, semuanya berada di bawah Mahkamah Agung. Tetapi untuk menjaga kemerdekaan hakim, dibentuk lembaga yang dikenal dengan Komisi Yudisial.

slide147
2. Kebijakandibidangpelayananhukum. Dalamhaliniperlupelayananhukum yang cepat, mudah, terjangkauolehmasyarakat, transparandanakuntabel. Dalamhalinijugadilakukankebijakan yang dapatmemberantasterjadinyaKorupsi, KolusidanNepotisme (KKN)
slide148
Kelima komponen arah kebijakan pembentukan hukum tersebut akan membentuk sistem hukum nasional. Hukum nasional itu akan berfungsi ditentukan oleh 5 faktor yang satu dengan yang lain saling menunjang dan tidak dapat dipisahkan satu dengan yang lainnya. Kelima faktor yang disebut dengan kondisi hukum tetap (conditio sine quanon) terdiri dari:
slide149
Substansi hukum /materi hukum

( legal substance)b. Budaya hukum (kesadaran hukum masyarakat ( legal culture)c. Aparatur penegak hukum

(legal aparatus)d. Sarana dan prasarana (equipment) e. Pendidikan hukum

(legal education)

slide150
Kedua lingkup utama arah kebijakan pembangunan hukum tersebut (kebijakan pembentukan perundang-undangan/hukum tertulis dan kebijakan penegakan hukum) tersebut hanya dapat dibedakan dan tidak dapat dipisahkan. Keduanya saling berkait dan berfungsi sebagai suatu sistem, dimana sub sistem yang lain merupakan satu kesatuan yang tidak dapat dipisahkan, dan saling berhubungan sebagai suatu totalitas.
slide151
Penegakan hukum merupakan dinamisator peraturan perundang-undangan . Melalui putusan dalam rangka penegakan hukum peraturan perundang-undangan menjadi hidup dan diterapkan sesuai dengan kebutuhan dan perkembangan masyarakat.
slide152
Pembentukanhukumdanpenegakanhukummelibatkan SDM, tatakerja, pengorganisasian, saranadanprasarana. SDM yang handal, pengorganisasian yang efektifdanefisien, saranadanprasarana yang memadaiakanturutmenentukankeberhasilanpembentukandanpenegakanhukum.
slide153
Politik pembentukan dan penegakan hukum harus disertai pula dengan politik pembinaan sumber daya manusia, tata kerja, pengorganisasian dan sarana/prasarana.
slide154
Hubungankausalitasantarahukum

danpolitikPolitikHukumsebagaikebijakanhukum (legal policy) ygsudah, akanatautelahdilaksanakansecaranasionalolehpemerintahmencakup pula pengertianbagaimanapolitikmempengaruhihukumdengancaramelihatkonfigurasikekuatan yang adadibelakangpembuatandanpenegakanhukum.

slide155
Bagaimana hubungan kausalitasnya, apakah hukum yg mempengaruhi politik atau politik yang mempengaruhi hukum ?.

Jawaban dapat berupa:

slide156
Hukum determinan atas politik dalam arti kegiatan-kegiatan politik di atur dan tunduk pada aturan-aturan hukum (mereka yg memandang hukum sebagai das sollen (keharusan) para idealis) b. Politik determinan atas hukum , karena hukum merupakan hasil atau kristalisasi dari kehendak politik yg saling berintegrasi dan bersaing. Mereka memandang hukum sebagai das sein, penganut empiris dan memandang realitas.c. Politik dan hukum sebagai subsistem kemasyarakatan berada pada posisi dan derajat determinan yang seimbang, sekalipun hukum produk politik tetapi jika hukum ada, politik harus tunduk pada hukum.
slide157
Dalampolitikhukumterdapatduavariabel, yaknivariabelterpengatur (hukum) danvariabel yang mempengaruhi (politik).
slide158
Dalam studi Politik Hukum kita tidak melihat hukum ansich das sollen tetapi juga das sain.Asumsi dasar disini “hukum merupakan produk politik”.Dalam melihat hubungan keduanya, hukum sebagai terpengaruh (dependent variable) dan politik sebagai variabel yang berpengaruh

(independent variable). Hukum dipengaruhi politik atau politik determinan atas hukum mudah dipahami dan realitasnya demikian karena hukum merupakan kristalisasi dari kehendak politik yang saling berintegrasi dilingkungan pengambil keputusan.

slide159
Dasar dan Corak PolitikAda pendapat yang diterima oleh umum bahwa hukum khususnya Peraturan Perundang-undangan merupakan produk politik. Bukan saja karena dibuat oleh DPR, Presiden, tetapi peraturan perundang-undangan pada dasarnya akan mencerminkan pemikiran dan kebijaksanaan yang paling berpengaruh di negara yang bersangkutan. Pikiran politik dan kebijakan politik yang berpengaruh tersebut dapat bersumber, kepada ideologi tertentu, kepentingan tertentu atau tekanan-tekanan sosial yang kuat dari masyarakat.
slide160
Gambarandiatasmenunjukkanpolitikhukummempunyaihubungandenganbidang lain. PenyusunanPolitikHukumharusdiusahakanseiringdenganaspek-aspekkebijakandibidangekonomi, politik, sosial, teknologidansebagainya. Demikian pula sebaliknya, kebijakandibidangekonomi, politik, sosial, teknologidan lain-lain tidakbolehmengabaikandasar-dasrdantatananhukum yang semestinyamelandasikebijakantersebut. Selainitupolitikhukumsangatdipengaruhiolehdoktrinkenegaraan, apakahdoktinsosialismeataupunkomunisme.
slide161
Corak Politik Hukum di bidang ekonomi di negara dengan doktrin sosialis akan berbeda dengan corak Politik Hukum di bidang ekonomi di negara dengan doktrin kapitalis. Hukum di bidang ekonomi di negara sosialis selalu memberi tempat pada negara dan pemerintah untuk mempengaruhi keadaan ekonomi. Sedangkan hukum di bidang ekonomi di negara kapitalis akan lebih banyak mencerminkan aturan yang menjamin ekonomi pasar.
slide162
Dalamprakteknyaakandijumpailingkupgabunganantaraberbagaisistemtergantungmateri yang diaturkarenatidakzamannyalagimembedakansecaratajamantaraserbanegaradanserbapasar. Bagikebanyakannegara, pendekatan yang serbaideologissudah lama danberangsur-angsurditinggalkan, termasukdalammenentukanpolitikhukum.
slide163
Politik hukum dinegara demokrasi akan berbeda dengan negara yang diperintah dengan diktator. Politik hukum pada negara demokrasi berusaha memberi peluang luas bagi keikutsertaan masyarakat menentukan corak dan isi hukum yang dikehendaki. Pada negara diktator akan selalu menghindari partisipasi masyarakat dalam menentukan corak dan isi hukum. Kehendak penguasa diktator selalu menjadi dasar kaedah dan menuntun penyerahan total warga pada kehendak penguasa.
slide164
Indonesia sebagai negara yang berdasarkan pancasila yang berdasarkan kekeluargaan mempunyai politik hukum tersendiri sesuai dengan cita hukum (rechts idee) yang terkandung dalam pancasila dan UUD Negara RI tahun 1945. Pada tataran politik, tujuan politik hukum Indonesia adalah tegaknya negara hukum yang demokratis. Pada tataran sosial dan ekonomi politik hukum bertujuan mewujudkan keadilan sosial bagi seluruh rakyat Indonesia dan sebesar-besarnya kemakmuran rakyat. Sedangkan pada tataran normatif, politik hukum normatif bertujuan tegaknya keadilan dan kebenaran dalam segala aspek kehidupan masyarakat. Seluruh tujuan tersebut berada dalam satu bingkai tatanan hukum nasional yang bersumber dan berdasarkan Pancasila dan UUD Negara RI tahun 1945.
kuliah 05

KULIAH 05

SEKILAS SINGKAT POLITIK HUKUM INDONESIA

slide166
KETIKA KOLONIAL PORTUGIS DATANG KE INDONESIA, BAHWA INDONESIA BUKAN SUATU WILAYAH YANG KOSONG DARI HUKUM (TANPA HUKUM), TAPI TELAH ADA HUKUM YANG HIDUP DALAM MASYARAKAT WAKTU ITU.
slide167
Portugis pada saat itu hanya memberlakukan hukum yang berlaku di atas kapal yang hanya berlaku untuk mereka sendiri tanpa melibatkan penduduk setempat.
slide168
Ketika Kolonial Belanda datang – demi kepentingannya dan untuk berinteraksi dengan penduduk/ masyarakat setempat dengan politik hukumnya telah memberlakukan hukum yang berlaku untuk mereka dan golongan/penduduk yang lain di Indonesia pada waktu itu.
slide169
POLITIK HUKUM INDONESIA ZAMAN PEMERINTAHAN KOLONIAL

HINDIA BELANDA

Pada masa AB (Algemen Bepalingen van Wetgeving voor Indonesia) - ketentuan umum tentang Peraturan Perundang-undangan untuk Indonesia - dikeluarkan pada 30 April 1847, termuat dalam Staatsblad (Stb.) 1847 No. 23, mulai berlaku 1 Mei 1848.

slide170
Pada masa AB ditentukan mengenai golongan penduduk :

Pasal 6 AB : Penduduk Indonesia/Hindia Belanda dibeda-bedakan menurut : orang-orang Eropa. Orang-orang Bumiputera, dan yang dipersamakan dengan ini.

slide171
Pasal 7 AB : yang dipersamakan dengan orang Eropa :
  • Semua orang-orang Kristen termasuk orang-orang Indonesia yang menganut agama tersebut.
  • Semua orang darimanapun asalnya, yang tidak termasuk dalam Pasal 8 di bawah ini.
  • Pasal 8 AB : yang dipersamakan dengan orang Bumiputera : orang Arab, orang Moor (Afrika), orang Tionghoa, dan semua orang yang beragama Islam atau kafir.
slide172
Pasal 10 AB : GubernurJendralberwenang, jikaperlumengadakanpengecualianterhadapketentuan-ketentuanpasalsebelumnyabagiorang-orangkristen Indonesia umumnyaataubagibeberapamasyarakatkristen Indonesia.
slide173
Berdasarkan Pasal 10 AB  Gubernur Jendral menentukan bahwa terhadap orang Indonesia beragama Kristen baik dalam lapangan Hukum Perdata dan Hukum Dagang dan juga mengenai Perundang-undangan Pidana dan peradilan pada umumnya akan tetap dalam kedudukan hukumnya yang lama. Hal ini berarti dalam praktek, orang Indonesia beragama Kristen tetap dianggap sebagai golongan Bumiputera.
slide174
Pada masa Regerings Reglement (RR) – (1855-1920)/RR Lama  pembagian golongan penduduk sama seperti pada masa AB. Tetapi untuk golongan yang dipersamakan ini, agama tidak lagi dipakai sebagai satu-satunya ukuran.

Orang Indonesia Kristen, tetap termasuk golongan Bumiputera. Juga Tionghoa, Arab, dan Insdia dipersamakan dengan Bumiputera dengan tidak mengingat agamanya. Sebaliknya orang-orang Amerika, Australia, Jepang dimasukkan ke dalam golongan Eropa.

slide175
Pada RR Baru (1 Januari 1920 – 1926), pembagian golongan penduduk dibedakan menjadi 3 (tiga) golongan :

Golongan Eropa.

Golongan Bumiputrera.

Golongan Timur Asing.

slide176
Pada masa IS (Indische Staatsregeling/Undang-undang Tentang Susunan Pemerintah Hindia-Belanda), Stb. 1925 No. 415, berlaku 1 Januari 1926.
slide177
Pasal 131 I.S : membagi penduduk di HB dalam tiga golongan penduduk : Eropa, Timur Asing (Tiong Hoa), Pribumi (bumi putera)

Pasal 163 I.S : menentukan hukum yang berlaku bagi masing-masing golongan penduduk.

slide178
HukumPidanaberlakuunifikasiyaituWvS (Wetboek van Straftrecht / KUHP).

UntukHukum Acara : Untuk Gol Eropa dan TimurAsing :  R.V

Untuk Gol Bumi Putera : H.I.R

UntukHukumPerdata : Eropa - HukumperdataBarat (BW dan WvK).

Timur Asing : Hukum Perdata Barat, kecuali beberapa bagian dari hukum keluarga (adat).

Bumi putera : Hukum Adat

slide179
ZAMAN PEMERINTAHAN PENJAJAHAN JEPANG (1942 -1945) mengeluarkan Osamu Seirei No. 1 Tahun 1942 yang menentukan “SemuaBadanPemerintahandanKekuasaannya, HukumdanUndang-undangdaripemerintahan yang dulutetapdiakuisahuntuksementarawaktu, asaltidakbertentangandenganperaturanmiliter”.
slide180
ZAMAN REPUBLIK INDONESIA (1945 - SEKARANG) UUD 1945: Pasal II AturanPeralihan -Konstitusi RIS Pasal 192 -KetentuanPeralihan UUDS 1950 Pasal 142 - KetentuanPeralihanUUD 1945 (hasilAmandemen IV) Pasal I dan II Aturan Peralihan :
slide181
MENENTUKAN BAHWA SEGALA BADAN NEGARA DAN PERATURAN YANG ADA MASIH BERLANGSUNG BERLAKU SELAMA BELUM DIADAKAN YAG BARU.

 DALAM HAL INI LANGSUNG BERLAKU/TETAP BERLAKU TERMASUK  LEMBAGA NOTARIAT YANG PADA WAKTU ITU BERDASARKAN Reglement op Het Notaris Ambt in Indonesia (Stbl. 1860 : 3).

slide183
LembagaNotarismasukke Indonesia padapermulaanabadke 17 denganberadanyaVereenigdeOost Ind. Compagnie (V.O.C)di Indonesia. Jan PieterszoonCoenpadawaktuitusebagaiGubernurJendraldiJacatra (Jakarta sekarang) antaratahun 1617 sampai 1629, untukkeperluanparapendudukdanparapedagangdi Jakarta menganggapperlumengangkatseorangNotaris, yang disebutNotariumPublicum, sejaktanggal 27 Agustus 1620, mengangkatMelchior Kerchem, sebagaiSekretarisCollege van Schepenen (UrusanPerkapalan Kota)diJacatrauntukmerangkapsebagaiNotaris yang berkedudukandiJacatra.
slide184
Tugas Melchior KerchemsebagaiNotarisdalamsuratpengangkatannya, yaitumelayanidanmelakukansemuasurat libel (smaadschrift),suratwasiatdibawahtangan(codicil), persiapanpenerangan, aktaperjanjianperdagangan, perjanjiankawin, suratwasiat(testament),danakta-aktalainnyadanketentuan-ketentuan yang perludarikotapraja.
slide185
Padatahun 1625 jabatanNotarisdipisahkandarijabatanSekretarisCollege van Schepenen,yaitudengandikeluarkanInstruksiuntukparaNotarispadatanggal 16 Juni 1625. Instruksiinihanyaterdiridari 10 (sepuluh) pasal, antara lain menetapkanbahwaNotariswajibmerahasiakansegalasesuatu yang dipercayakankepadanyadantidakbolehmenyerahkansalinan-salinandariakta-aktakepadaorang-orang yang tidakberkepentingan
slide186
Tanggal 7 Maret 1822 (Stb. No. 11) dikeluarkanInstructievoor de NotarissenResiderende in Nederlands Indie.Pasal 1 Instruksitersebutmengatursecarahukumbatas-batasdanwewenangdariseorangNotaris, danjugamenegaskanNotarisbertugasuntukmembuatakta-aktadankontrak-kontrak, denganmaksuduntukmemberikankepadanyakekuatandanpengesahan, menetapkandanmemastikantanggalnya, menyimpanasliatauminutanyadanmengeluarkangrossenya, demikianjugamemberikansalinannya yang sahdanbenar
slide187
Tahun 1860 PemerintahHindiaBelandamemandangperluuntukmembuatperaturan-peraturan yang barumengenaiJabatanNotarisdiNederlands Indie untukdisesuaikandengandenganperaturan-peraturanmengenaijabatanNotaris yang berlakudiBelanda. SebagaipenggantiInstructievoor de NotarissenResiderende in Nederlands Indie, kemudiantanggal 1 Juli 1860 ditetapkanReglement op Het NotarisAmbt in Nederlands Indie (Stbl. 1860 : 3).
slide188
Setelah Indonesia merdeka, 17 Agustus 1945, keberadaan Notaris di Indonesia tetap diakui beradasarkan ketentuan Pasal II Aturan Peralihan (AP) Undang-undang Dasar (UUD) 1945, yaitu Segala peraturan perundang-undangan yang ada masih tetap berlaku selama belum diadakan yang baru menurut Undang-undang dasar ini.Dengan dasar Pasal II AP tersebut tetap diberlakukan Reglement op Het Notaris Ambt in Nederlands Indie (Stbl. 1860 : 3). Sejak tahun 1948 kewenangan pengangkatan Notaris dilakukan oleh Menteri Kehakiman, berdasarkan Peraturan Pemerintah Tahun 1948 Nomor 60, tanggal 30 Oktober 1948 tentang Lapangan Pekerjan, Susunan, Pimpinan dan Tugas Kewajiban Kementerian Kehakiman.
slide189
Tahun 1949 melaluiKonfrensiMejaBundar (KMB) yang dilaksanakandi Den Haag, Nederland, tanggal 23 Agustus – 22 September 1949, salahsatuhasil KMB terjadiPenyerahanKedaulatandariPemerintahanBelandakepadaRepublik Indonesia Serikatuntukseluruh Wilayah Indonesia (kecualiIrian Barat – Papua sekarang), adanyapenyerahankedaulatantersebut, membawaakibatkepada status Notaris yang berkewarganegaraanBelanda yang adadi Indonesia, harusmeninggalkanjabatannya.
slide190
DengandemikianterjadikekosonganNotarisdi Indonesia, untukmengisikekosongantersebutsesuaidengankewenangan yang adapadaMenteriKehakimanRepublik Indonesia Serikatdaritahun 1949 sampaidengantahun 1954 menetapkandanmengangkatWakilNotarisuntukmenjalankantugasJabatanNotarisdanmenerimaprotokol yang berasaldariNotaris yang berkewarnegaraanBelanda.
slide191
Tanggal 13 November 1954 Pemerintah Republik Indonesia mengeluarkan Undang-undang Nomor 33 Tahun 1954 Tentang Wakil Notaris dan Wakil Notaris Sementara. Pasal 2 ayat (1) undang-undang tersebut, menegaskan bahwa dalam hal Notaris tidak ada, Menteri Kehakiman dapat menunjuk seorang yang diwajibkan menjalankan pekerjaan-pekerjaan Notaris
slide192
Mereka yang ditunjuk dengan kewajiban seperti tersebut dalam pasal ini disebut sebagai Wakil Notaris (Pasal 1 huruf c dan Pasal 8 Undang-undang Nomor 33 Tahun 1954), selanjutnya dalam Pasal 2 ayat (2) disebutkan, sambil menunggu ketetapan dari Menteri Kehakiman, Ketua Pengadilan Negeri dapat menujuk seorang untuk sementara diwajibkan menjalankan pekerjaan-pekerjaan Notaris.
slide193
Mereka yang ditunjuk dengan kewajiban seperti tersebut dalam pasal ini disebut sebagai Wakil Notaris Sementara (Pasal 1 huruf d Undang-undang Nomor 33 Tahun 1954), sedangkan yang disebut Notaris adalah mereka yang diangkat berdasarkan ketentuan Pasal 2 ayat (1) Reglement op Het Notaris Ambt in Nederlands Indie (Stbl. 1860 : 3) – (Pasal 1 huruf a Undang-undang Nomor 33 Tahun 1954). Undang-undang Nomor 33 Tahun 1954 juga sekaligus menegaskan berlakunya Reglement op Het Notaris Ambt in Nederlands Indie (Stbl. 1860 : 3) sebagai Reglemen tentang Jabatan Notaris di Indonesia (Pasal 1 huruf a) untuk Notaris Indonesia
slide194
Notaris yang masih berada di Indonesia sampai dengan tahun 1954 merupakan Notaris (berkewarganegaraan Belanda) yang diangkat oleh Gubernur Jendral (Gouverneur Generaal) berdasarkan Pasal 3 Reglement op Het Notaris Ambt in Nederlands Indie (Stbl. 1860 : 3). Ketentuan pengangkatan Notaris oleh Gubernur Jendral (Gouverneur Generaal) oleh Undang-undang Nomor 33 Tahun 1954 telah dicabut, yaitu tersebut dalam Pasal 2 ayat 3, dan juga mencabut Pasal 62, 62a dan 63 Reglement op Het Notaris Ambt in Nederlands Indie (Stbl. 1860 : 3).
slide195
Tahun 2004 diundangkanUndang-undangNomor 30 Tahun 2004 TentangJabatanNotarisataudisebut UUJNpadatanggal 6 Oktober 2004. Pasal 91 UUJN telahmencabutdanmenyatakantidakberlakulagi :
slide196
Reglement op Het Notaris Ambt in Indonesia (Stbl. 1860 : 3)sebagaimana telah diubah terakhir dalam Lembaran Negara 1954 Nomor 101;
  • Ordonantie 16 September 1931 tentang Honorarium Notaris.
  • Undang-undang Nomor 33 Tahun 1954.
  • Pasal 54 Undang-undang Nomor 8 Tahun 2004 tentang Perubahan Atas Undang-undang Nomor 2 Tahun 1986 Tentang Peradilan Umum.
  • Peraturan Pemerintah Nomor 11 Tahun 1949, tentang Sumpah/janji Jabatan Notaris.
slide198
UUJN TIDAK MEMERLUKAN PERATURAN PEMERINTAH.
  • ADA 6 (ENAM) PASAL DALAM UUJN YANG DAPAT DITINDAK LANJUTI DENGAN PERATURAN MENTERI HUKUM DAN HAM RI.
slide199
PASAL 14  SYARAT DAN TATA CARA PENGANGKATAN DAN PEMBERHENTIAN NOTARIS.

PASAL 16 AYAT (6)  BENTUK DAN UKURAN CAP/STEMPEL.

PASAL 20 AYAT (3)  PERSYARATAN DALAM MENJALANKAN PERSERIKATAN PERDATA NOTARIS.

PASAL 22 AYAT (2)  FORMASI JABATAN NOTARIS.

PASAL 23 AYAT (5)  TATA CARA PERMOHONAN PINDAH WILAYAH JABATAN NOTARIS.

PASAL 81  TATA CARA PENGANGKATAN DAN PEMBERHENTIAN ANGGOTA, SUSUNAN ORGANISASI DAN TATA CARA PEMERIKSAAN MAJELIS PENGAWAS.

slide200
SAMPAI SAAT INI TELAH DITERBITKAN :
  • PERATURAN MENTERI HUKUM DAN HAK ASASI MANUSIA REPUBLIK INDONESIA NOMOR : M. 02. PR. 08. 10 TAHUN 2004 TENTANG TATA CARA PENGANGKATAN ANGGOTA, PEMBERHENTIAN ANGGOTA, SUSUNAN ORGANISASI, TATA CARA KERJA, DAN TATA CARA PEMERIKSAAN MAJELIS PENGAWAS NOTARIS.
  • KEPUTUSAN MENTERI HUKUM DAN HAK ASASI MANUSIA REPUBLIK INDONESIA NOMOR : M. 39 – PW. 07. 10 TAHUN 2004 TENTANG PEDOMAN PELAKSANAAN TUGAS MAJELIS PENGAWAS NOTARIS.
  • PERATURAN MENTERI HUKUM DAN HAK ASASI MANUSIA REPUBLIK INDONESIA NOMOR : M. 01. HT. 03. 01 TAHUN 2006 TENTANG SYARAT DAN TATA CARA PENGANGKATAN, PERPINDAHAN, DAN PEMBERHENTIAN NOTARIS.
slide201
PERATURAN MENTERI HUKUM DAN HAK ASASI MANUSIA REPUBLIK INDONESIA NOMOR : M. 03. HT. 03. 10 TAHUN 2007 TENTANG PENGAMBILAN MINUTA AKTA DAN PEMANGGILAN NOTARIS.
  • PERATURAN MENTERI HUKUM DAN HAK ASASI MANUSIA REPUBLIK INDONESIA NOMOR : M. 02. HT. 03. 10 TAHUN 2007 TENTANG BENTUK DAN UKURAN CAP/STEMPEL NOTARIS.
  • PERATURAN MENTERI HUKUM DAN HAK ASASI MANUSIA REPUBLIK INDONESIA NOMOR : M. HH-05 . AH. 11. TAHUN 2009 TENTANG FORMASI JABATAN NOTARIS.
  • PERATURAN MENTERI HUKUM DAN HAK ASASI MANUSIA REPUBLIK INDONESIA NOMOR : M. HH. 01. AH. 021. 12 TAHUN 2011 TENTANG PERSYARATAN MENJALANKAN JABATAN NOTARIS DALAM BENTUK PERSERIKATAN PERDATA.
slide202
PolitikHukumKenotariatanadalahkebijakandasarpenyelenggaraannegaradalambidanghukum (kenotariatan) yang akan, sedangdantelahberlaku, bersumberdarinilai-nilai yang berlakudalammasyarakatuntukmencapaitujuannegara yang dicita-citakan, khususnyadalampembuatanalatbuktiotentik yang diakuiolehnegara.
catatan 1

CATATAN 1 :

KHUSUS DALAM BIDANG KEPENDUDUKAN/

KEWARGANEGARAAN INDONESIA (SUDAH TIDAK MENGANUT) DIKSKRIMINASI BERDASARKAN GOLONGAN PENDUDUK, SEPERTI TERSEBUT DALAM :

slide204
Pasal 2 Undang-undang Nomor 12 Tahun 2006 tentang Kewarganegaraan menegaskan, bahwa yang menjadi Warga Negara Indonesia adalah orang-orang bangsa Indonesia asli dan orang-orang bangsa lain yang disahkan dengan undang-undang sebagai warga negara. Dalam Penjelasan Pasal 2 tersebut, ditegaskan pula bahwa yang dimaksud dengan orang-orang bangsa Indonesia asli adalah orang Indonesia yang menjadi Warga Negara Indonesia (WNI) sejak kelahirannya dan tidak pernah menerima kewarganegaraan lain atas kehendak sendiri. Dengan demikian bahwa bangsa Indonesia asli tidak didasarkan kepada suku atau etnis tertentu saja, tapi adalah mereka telah menjadi Warga Negara Indonesia sejak kelahirannya di bumi Indonesia dan tidak pernah menerima kewarganegaraan lain atas keinginan atau kehendak sendiri.
slide205
Padasisi yang lain kelahiranUndang-undangKewarganegaraantersebutmemberikandampakhukum yang lain, yaituterhadapkedudukanaturanhukum yang diberlakukanberdasarkanetnistertentu, dalamartibagaimanakedudukanaturanhukum yang diberlakukanberdasarkanetnispaskaberlakunyaUndang-undangKewarganegaraantersebut..? Apakahaturanhukumtersebutmasihberlakusecaraimperatif, fakultatifataualternatif…? Sebagaicontohbahwa B.W. padaawalberlakunyahanyauntukgolonganatauetnistertentu, yaituberdasarkan S. 1847 – 23 yang menegaskanbahwa B.W. hanyaberlakubagi : (1) orang-orangEropa; (2) orang-orang Indonesia turunanEropa; dan (3) orang-orang yang disamakandenganorang-orangEropa, yaitumereka yang padasaatituberagama Kristen. Kemudianketentuantersebutberlaku pula kepadaatauberdasarkangolonganpenduduk yang dibuatolehPemerintahHindiaBelanda (Pasal 163 IS), bahwapendudukdiHindiaBelandadibagidalam 3 (tiga) golongan, yaitu (1) GolonganEropa; (2) GolonganTimurAsing, dan (3) GolonganBumiputera/Indonesia Asli.
slide206
Berdasarkan etnis/golongan penduduk tersebut sejak tahun 1919 terhadap Golongan Timur Asing, antara lain Cina dikenakan hampir seluruh ketentuan dalam B.W. dan Wv.K. dan terhadap Golongan Timur Asing bukan Cina diberlakukan B.W. mengenai Hukum Harta Kekayaan, disamping berlaku pula hukum dari asal negara mereka, dan untuk golongan Indonesia Asli berlaku Hukum Adat. Meskipun kemudian Mahkamah Agung Republik Indonesia dengan Surat Edaran nomor 3/1963, tanggal 5 September 1963, menganggap B.W. tidak sebagai undang-undang, melainkan sebagai suatu dokumen yang hanya menggambarkan suatu kelompok hukum yang tidak tertulis. Dengan berlakunya Undang-undang Kewarganegaraan tersebut, maka semua aturan hukum yang berlaku untuk etnis tertentu secara imperatif sudah tidak berlaku lagi untuk golongan penduduk atau etnis tertentu, tapi aturan hukum tersebut bersifat alternatif atau fakultatif saja untuk Warga Negara Indonesia.
catatan 2
Dalam praktek Notaris di Indonesia telah biasa membuat Surat Keterangan Waris (SKW) untuk mereka yang termasuk ke dalam etnis Cina. Praktek Notaris seperti ini tidak pernah ada pengaturannya dalam PJN, tapi hanya merupakan kebiasaan Notaris yang sebelumnya, kemudian diikuti secara langsung oleh Notaris yang datang kemudian, tanpa mencari maksud dan tujuannya, tanpa bertanya, kenapa pembuatan bukti ahli waris di Indonesia harus dibedakan berdasarkan etnis ? Hal semacam ini merupakan bentuk diskriminasi dalam pembuatan bukti ahli waris. Meskipun telah menjadi kebiasaan bagi para Notaris untuk membuat SKW, ternyata kebiasaan tersebut tidak dimasukkan dalam UUJN, karena tidak dimasukkan sebagai bagian dari UUJN, maka kebiasaan seperti itu sudah tidak dapat dilakukan lagi oleh para Notaris. Jika Notaris masih mempraktekkan seperti itu dalam pembuatan bukti waris membuktikan bahwa Notaris bukan agen pembaharuan hukum, tapi mempraktekkan atau bertindak diskriminasi untuk Warga Negara Indonesia berdasarkan etnis, dan juga pembuatan SKW tersebut termasuk suatu tindakan diluar wewenang atau tidak sesuai dengan wewenang Notaris berdasakan Pasal 15 UUJN. CATATAN 2 :
slide208
Diskriminasidalampembuatanbuktisebagaiahliwaris yang masihberdasarkanetnis (suku/golonganpenduduk Indonesia) jugamasihterdapatdalam : (a) SuratDepartemenDalamNegeriDirektoratJendralAgariaDirektoratPendaftaran Tanah (Kadaster), tanggal 20 Desember 1969, nomorDpt/12/63/12/69 tentangSuratKeteranganWarisandanPembuktianKewarganegaraan, dan (b) Pasal 111 ayat (1) huruf c PeraturanMenteri Negara Agraria/KepalaBadanPertanahanNasionalNomor 3 Tahun 1997 tentangKetentuanPelaksanaanPeraturanPemerintahNomor 24 Tahun 1997 tentangPendaftaran Tanah.
slide209
Sebagai sebuah negara kesatuan, sudah saatnya diskriminasi dalam pembuatan bukti sebagai ahli waris seperti tersebut di atas untuk diakhiri, dengan mencabut aturan hukum tersebut atau untuk tidak memberlakukan aturan hukum tersebut, karena bertentangan dengan aturan hukum yang lebih tinggi, yaitu bahwa status sebagai Warga Negara Indonesia sudah tidak lagi berdasarkan etnis (Pasal 2 dan Penjelasnnya Undang-undang Nomor 12 Tahun 2006).
slide210
Notariswajibmenempatkandirisebagaisatu-satunyapejabat yang dapatmembuatbuktisebagaiahliwarisdalambentukaktapihakuntukseluruhWarga Negara Indonesia tanpaberdasarkanetnistertentu. TindakanNotarisinisesuaidenganwewenangNotarisdalamPasal 15 ayat (1) UUJN, danPasal 2 danPenjelasannyaUndang-undangnomor 12 Tahun 2006 tentangKewarganegaraan, yang menegaskanbahwa yang dimaksuddenganbangsa Indonesia asliadalahorang Indonesia yang menjadiWarga Negara Indonesia sejakkelahirannyadantidakpernahmenerimakewaraganegaraannegara lain ataskehendaksendiri.
kuliah 06

KULIAH 06

DIMENSI POLITIK HUKUM DARI/DALAM UNDANG-UNDANG JABATAN NOTARIS.

slide212
POLITIK HUKUM SEPERTI APA YANG DIHARAPKAN DARI UUJN UNTUK NOTARIS INDONESIA ?

HAL INI DAPAT DIKAJI DARI SUBSTANSI UNDANG-UNDANG JABATAN NOTARIS (UUJN).

slide213
UUJN MEMBERIKAN/MERUPAKAN GRAND DESIGN/ ARSITEKTUR/GAMBARAN NOTARIS INDONESIA DAN JUGA ARAHAN POLITIK HUKUM KENOTARIATAN INDONESIA
slide214
Dalam KONSIDERANS UUJN ditegaskan bahwa :

a.bahwa Negara Republik Indonesia sebagai negara hukum berdasarkan Pancasila dan Undang-Undang Dasar Negara Republik Indonesia Tahun 1945 menjamin kepastian, ketertiban, dan perlindungan hukum, yang berintikan kebenaran dan keadilan;

slide215
b. bahwa untuk menjamin, kepastian, dan perlindungan hukum dibutuhkan alat bukti tertulis yang bersifat otentik mengenai keadaan, peristiwa, atau perbuatan hukum yang diselenggarakan melalui jabatan tertentu;
slide216
Melalui Jabatan tertentu (Notarisi) yang diberikan kewenangan untuk membuat alat bukti yang :

menjamin :

Kepastian hukum,

ketertiban, dan

perlindungan hukum,

yang berintikan kebenaran dan

keadilan;

slide217
c. bahwa notaris merupakan jabatan tertentu yang menjalankan profesi dalam pelayanan hukum kepada masyarakat, perlu mendapatkan perlindungan dan jaminan demi tercapainya kepastian hukum;

d. bahwa jasa notaris dalam proses pembangunan makin meningkat sebagai salah satu kebutuhan hukum masyarakat;

slide218
e. bahwa Reglement op Het Notaris Ambt in Indonesia (Stb.1860:3) yang mengatur mengenai jabatan dan kebutuhan masyarakat;

f. bahwa berdasarkan pertimbangan sebagaimana dimaksud dalam huruf a, huruf b, huruf c, huruf d, dan huruf e, perlu membentuk Undang-Undang tentang Jabatan Notaris;

slide219
Ditegaskan dalam Penjelasan UUJN bagian Umum, UUJN merupakan pembaharuan dan pengaturan kembali secara menyeluruh dalam satu undang-undang yang mengatur tentang jabatan Notaris sehingga dapat tercipta suatu unifikasi hukum yang berlaku untuk semua penduduk di seluruh wilayah negara Republik Indonesia.

Dengan demikian UUJN merupakan satu-satunya undang-undang yang mengatur Jabatan Notaris di Indonesia

slide221
Jabatan Notaris merupakan suatu lembaga yang diciptakan oleh Negara

(Suatu lembaga yang dibuat atau diciptakan oleh negara, baik kewenangan atau materi muatannya – tidak berdasarkan pada peraturan perundang-undangan, delegasi atau mandat melainkan berdasarkan wewenang yang timbul dari freis ermessen yang dilekatkan pada administrasi negara untuk mewujudkan suatu tujuan tertentu yang dibenarkan oleh hukum (Beleidsregel atau Policyrules). Bagir Manan, Hukum Positif Indonesia, UII Press, Yogyakarta, 2004, hal. 15).

slide222
Sebagai sebuah undang-undang yang memperbaharui pengaturan jabatan Notaris tidak mudah untuk diterapkan sebagaimana keinginan pemerintah (dalam hal ini Departemen Hukum dan Hak Asasi Manusia Republik Indonesia) dan para Notaris sebagai pihak yang diatur dengan UUJN tersebut, dan juga masyarakat yang membutuhkan jasa Notaris. Salah satu contoh pembaharuan yang dilakukan yaitu tidak lagi memberikan atribut (sebutan) kepada Notaris sebagai satu-satunya Pejabat Umum yang berwenang membuat akta Otentik (Pasal 1 ayat (1) UUJN). Hal ini berbeda dengan Pasal 1 PJN yang menegaskan bahwa Notaris adalah satu-satunya Pejabat Umum yang berwenang (uitsluit bevoedg) membuat akta otentik.
slide223
Bahwa Notaris hadir/lahir untuk menjalankan sebagian kewenangan negara/pemerintah dalam bidang hukum perdata (khususnya dalammpembuatan alat bukti tertulis yang dilindungi/dijamin/diakui oleh negara/pemerintah dalam bentuk akta Notaris) yang diberikan kepada Notaris.
slide224
Dengan kedudukan hukum sebagaimana tersebut di atas (untuk menjalankan sebagian kewenangan negara/pemerintah dalam bidang hukum perdata), maka kepada Notaris :
slide225
Menggunakan lambang negara “Garuda Pancasila” pada kop/surat jabatan(Pasal 54 ayat : 1 huruf k Undang-undang No. 24/2009 tentang Bendera, Bahasa dan Lambang Negara serta Lambang Kebangsaan).

Kedudukan akta Notaris sebagai alat bukti yang lengkap dan sempurna, dijamin oleh negara.

slide226
3.Dalam aktaNotarisdidalamnyaada :

buktitulisan;

buktidengansaksi-saksi;

persangkaan-persangkaan;

pengakuan;

sumpah.

(Pasal 138, 165, 167 HIR, 164, 285 – 305 Rbg, S. 1867 nomor 29,

Pasal 1867 – 1894 B.W).

slide228
SALAH SATU TUGAS JABATAN NOTARIS, YAITU MEMFORMULASIKAN KEINGINAN/TINDAKAN PENGHADAP/PARA PENGHADAP KEDALAM BENTUK AKTA OTENTIK SESUAI ATURAN HUKUM YANG BERLAKU(HabibAdjie).
slide229
AKTA NOTARIS/PPAT SEBAGAI AKTA OTENTIK MEMPUNYAI KEKUATAN PEMBUKTIAN YANG SEMPURNA, SEHINGGA JIKA ADA ORANG/PIHAK YANG MENILAI ATAU MENYATAKAN BAHWA AKTA TERSEBUT TIDAK BENAR, MAKA ORANG/PIHAK YANG MENILAI ATAU MENYATAKAN TERSEBUT WAJIB MEMBUKTIKAN PENILAIAN ATAU PERNYATAANNYA SESUAI ATURAN HUKUM (HabibAdjie).
slide230
MESKIPUN AKTA NOTARIS TELAH DINYATAKAN TIDAK MENGIKAT OLEH PUTUSAN PENGADILAN YANG TELAH MEMPUNYAI KEKUATAN HUKUM YANG TETAP ATAU TELAH DIBATALKAN OLEH PARA PIHAK SENDIRI,, MAKA KEPADA NOTARIS YANG BERSANGKUTAN ATAU KEPADA PEMEGANG PROTOKOLNYA MASIH TETAP BERKEWAJIBAN UNTUK MENGELUARKAN SALINANNYA ATAS PERMINTAAN PARA PIHAK ATAU PENGHADAP ATAU PARA AHLI WARISNYA. (Habib Adjie).
slide232
KEDUA,NOTARIS HANYA MEMFORMULASIKAN KEINGINAN PARA PIHAK AGAR TINDAKKANNYA DITUANGKAN KEDALAM BENTUK AKTA OTENTIK ATAU AKTA NOTARIS.
slide233
KETIGA,KEINGINAN ATAU NIAT UNTUK MEMBUAT AKTA TERTENTU TIDAK AKAN PERNAH BERASAL DARI NOTARIS, TAPI SUDAH PASTI BERASAL KEINGINAN PARA PIHAK SENDIRI. MAKA DENGAN KONTRUKSI HUKUM SEPERTI ITU, SUATU HAL YANG SANGAT SULIT DITERIMA BERDASARKAN LOGIKA HUKUM YAITU JIKA NOTARIS DIDUDUKKAN SEBAGAI TERGUGAT YANG BERKAITAN DENGAN AKTA YANG DIBUAT DI HADAPAN ATAU OLEH NOTARIS
slide234
BAHWA NOTARIS MEMPUNYAI KEWENANGAN UNTUK MELAKSANAKAN TUGAS JABATANNYA, SELAMA KEWENANGAN TERSEBUT MELEKAT PADA DIRINYA. KEWENANGAN TERSEBUT BERAKHIR, JIKA NOTARIS YANG BERSANGKUTAN CUTI (BERAKHIR SEMENTARA) ATAU PENSIUN ATAU BERHENTI SEBAGAI NOTARIS. DAN BATAS PERTANGGUNGJAWABAN NOTARIS SELAMA-SEPANJANG NOTARIS MEMPUNYAI KEWENANGAN. NOTARIS YANG SEDANG CUTI, PENSIUN ATAU TELAH BERHENTI TIDAK DAPAT DIMINTAI LAGI PERTANGGUNGJAWABANNYA, KARENA SUDAH TIDAK ADA KEWENANGAN LAGI PADA DIRINYA (Habib Adjie).
slide235
JUDEX FACTIE DALAM AMAR PUTUSANNYA MEMBATALKAN AKTA NOTARIS, HAL INI ADALAHTIDAK DAPAT DIBENARKAN, KARENA NOTARIS FUNGSINYA HANYA MENCATATKAN/MENULISKAN APA-APA YANG DIKEHENDAKI DAN DIKEMUKAKAN OLEH PARA PIHAK YANG MENGHADAP NOTARIS TERSEBUT. TIDAK ADA KEWAJIBAN BAGI NOTARIS UNTUK MENYELIDIKI SECARA MATERIL APA-APA (HAL-HAL) YANG DIKEMUKAKAN OLEH PENGHADAP DI HADAPAN NOTARIS TERSEBUT (PutusanMahkamahAgungnomor : 702K/Sip/1973, 5 September 1973).
slide236
AKTA OTENTIK, MENURUT KETENTUAN EX PASAL 165 HIR JO PASAL 265 Rbg JO PASAL 1868 BW MERUPAKAN BUKTI YANG SEMPURNA BAGI KEDUA BELAH PIHAK, PARA AHLI WARISNYA DAN ORANG YANG MENDAPAT HAK DARINYA. AKTA OTENTIK INI MASIH DAPAT DILUMPUHKAN OLEH BUKTI LAWAN. DISAMPING ADANYA BUKTI OTENTIK, HAKIM SEHARUSNYA MEMPERHATIKAN DAN MENELITI PULA BUKTI LAWAN, BERUPA SURAT DI BAWAH TANGAN DAN TIDAK BEGITU SAJA MENGENYAMPINGKAN DAN TIDAK MEMBERIKAN PENILAIANNYA TENTANG DAPAT TIDAKNYA MELUMPUHKAN BUKTI OTENTIK YANG ADA. ADANYA BUKTI AKTA OTENTIK BUKANLAH SATU-SATUNYA KEHARUSAN UNTUK SUATU FAKTA HUKUM (PutusanMahkamahAgungnomor : 3199K/Pdt/1992, 27 Oktober 1994).
slide237
SUATU AKTA NOTARIS SEBAGAI AKTA OTENTIK YANG ISINYA MEMUAT 2 (DUA) PERBUATAN HUKUM, YAITU : (1) PENGAKUAN HUTANG, DAN (2) KUASA MUTLAK UNTUK MENJUAL TANAH. MAKA AKTA NOTARIS INI TELAH MELANGGAR ADAGIUM, BAHWA SATU AKTA OTENTIK HANYA BERISI SATU PERBUATAN HUKUM SAJA. AKTA NOTARIS YANG DEMIKIAN ITU TIDAK MEMILIKI EXECUTORIAL TITEL EX PASAL 224 HIR DAN TIDAK SAH. DEMIKIAN PULA KUASA MUTLAK BERTENTANGAN DENGAN INSTRUKSI MENDAGRI NO. 14/1982, SEHINGGA BATAL DEMI HUKUM.(PutusanMahkamahAgungnomor : 1440 K/Pdt/1996, 30 Juni 1998).
kuliah 07

KULIAH 07

UUJN  GRAND DESIGN/ARSITEKTUR/

GAMBARAN NOTARIS INDONESIA

slide239
NOTARIAT

NOTARIS

(MEREKA

PENYANDANG

JABATAN NOTARIS)

LEMBAGA

NOTARIAT

slide240
Terhadap Notaris UUJN mengkualifikasikannya sebagai JABATAN

1. UUJN – sebagai Undang-undang JABATAN Notaris.

2. Konsideran UUJN huruf c : bahwa notaris merupakan jabatan tertentu.

3. Pasal 1 angka 5 UUJN : Organisasi Notaris adalah organisasi ….. jabatan notaris

slide241
Penyebutan Notaris sebagai Jabatan dalam UUJN tidak konsisten, karena dalam UUJN disebut pula Notaris sebagai suatu Profesi atau sebagai suatu Profesi Jabatan. Misalnya dalam UUJN pada Konsideran Menimbang huruf c disebutkan, bahwa Notaris merupakan jabatan yang menjalankan Profesi. Pasal 1 angka 5 UUJN, disebutkan bahwa Organisasi Notaris adalah organisasi Profesi Jabatan Notaris. Seharusnya tetap dibaca Notaris sebagai suatu Jabatan.
slide242
Pengertian Jabatan dan Profesi berbeda. Kehadiran lembaga Notaris merupakan Beleidsregel dari Negara dengan Undang-undang nomor 30 Tahun 2004 tentang Jabatan Notaris (UUJN) atau Jabatan Notaris sengaja diciptakan negara sebagai implementasi dari Negara dalam memberikan pelayanan kepada rakyat, khususnya dalam pembuatan alat bukti yang otentik yang diakui

oleh Negara.

Profesi lahir sebagai hasil interaksi diantara sesama anggota masyarakat, yang lahir dan dikembangkan oleh masyarakat sendiri.

slide243
PERLU DIPAHAMI MENGENAI :1. JABATAN 2. PEJABAT3. PEJABAT NEGARA 4. PEJABAT TATA USAHA NEGARA5. PEJABAT PUBLIK 6. PEJABAT UMUM 7. NOTARIS SEBAGAI PEJABATPUBLIK 8. JABATAN NOTARIS 9. PERTANGGUNGJAWABAN NOTARIS, PEJABAT SEMENTARA NOTARIS, NOTARIS PENGGANTI DAN NOTARIS PENGGANTI KHUSUS
jabatan
JABATAN

-JABATAN MERUPAKAN SUATU BIDANG PEKERJAAN ATAU TUGAS YANG SENGAJA DIBUAT OLEH ATURAN HUKUM UNTUK KEPERLUAN DAN FUNGSI TERTENTU SERTA BERSIFAT BERKESINAMBUNGAN SEBAGAI SUATU LINGKUNGAN PEKERJAAN TETAP.

-JABATAN MERUPAKAN SUATU SUBJEK HUKUM, YAKNI PENDUKUNG HAK DAN KEWAJIBAN.

-AGAR SUATU JABATAN DAPAT BERJALAN MAKA JABATAN TERSEBUT DISANDANG OLEH SUBJEK HUKUM LAINNYA YAITU ORANG.

-ORANG YANG DIANGKAT UNTUK MELAKSANAKAN JABATAN DISEBUT PEJABAT. SUATU JABATAN TANPA ADA PEJABATNYA, MAKA JABATAN TERSEBUT TIDAK

DAPAT BERJALAN.

slide245
PEJABAT

PEJABAT ADALAH YANG MENJALANKAN HAK DAN KEWAJIBAN JABATAN. PEJABAT (YANG MENDUDUKI JABATAN) SELALU BERGANTI-GANTI, SEDANGKAN JABATAN TERUS-MENERUS (CONTINUE), ARTINYA PEJABAT BISA DIGANTIKAN OLEH SIAPAPUN, SEDANGKAN JABATAN AKAN TETAP ADA SELAMA DIPERLUKAN DALAM SUATU STRUKTUR PEMERINTAH ATAU ORGANISASI.

slide246
HUBUNGAN ANTARA JABATAN DENGAN PENJABAT, BAGAIKAN 2 (DUA) SISI MATA UANG, PADA SATU SISI BAHWA JABATAN BERSIFAT TETAP (LINGKUNGAN PEKERJAAN TETAP). SISI YANG KEDUA BAHWA JABATAN DAPAT BERJALAN OLEH MANUSIA SEBAGAI PENDUKUNG HAK DAN KEWAJIBAN SEHINGGA YANG MENGISI ATAU MENJALANKAN JABATAN DISEBUT PEJABAT ATAU PEJABAT ADALAH YANG MENJALANKAN HAK DAN KEWAJIBAN JABATAN.
  • OLEH KARENA ITU SUATU JABATAN TIDAK AKAN BERJALAN JIKA TIDAK ADA PEJABAT YANG MENJALANKANNYA.
  • KATA PEJABAT LEBIH MENUNJUK KEPADA ORANG YANG MEMANGKU SUATU JABATAN. SEGALA TINDAKAN YANG DILAKUKAN OLEH PEJABAT YANG SESUAI DENGAN KEWENANGANNYA MERUPAKAN IMPLEMENTASI DARI JABATAN.
slide247
PEJABAT NEGARA

DALAM ATURAN HUKUM TERSEBUT MENENTUKAN MEREKA YANG MENJADI PIMPINAN ATAU ANGGOTA TINGGI NEGARA/TERTINGGI NEGARA SEBAGAIMANA TERSEBUT DI ATAS DIKUALIFIKASIKAN SEBAGAI PEJABAT NEGARA. PENGERTIAN INI MENUNJUK KEPADA ORANG (SUBJEK) HUKUM YANG MENJADI PIMPINAN ATAU ANGGOTA TINGGI/TERTINGGI NEGARA.

slide248
PENYEBUTAN SEBAGAI PEJABAT NEGARA YANG SECARA OTONOM MEMPEROLEH WEWENANGNYA :

- BERDASARKAN ATAU MENGACU KEPADA ATURAN

HUKUM YANG MENGATUR JABATAN TERSEBUT.

- SECARA HIRARKIS BUKAN BAWAHAN PEJABAT

NEGARA YANG LAINNYA.

  • WEWENANG SEPERTI INI DISEBUT SEBAGAI DESENTRALISASI, YAITU WEWENANG DILAKSANAKAN OLEH PARA PEJABAT YANG DALAM PELAKSANAAN WEWENANG ITU SECARA HIRARKIS TIDAK BERADA DI BAWAH SUATU KEKUASAAN YANG LEBIH TINGGI.
  • WEWENANG DEKOSENTRASI MERUPAKAN WEWENANG YANG DAPAT DILAKSANAKAN OLEH MEREKA (PARA PEGAWAI) YANG SECARA HIRARKIS MASIH PEGAWAI RENDAHAN YANG MEMILIKI WEWENANG ITU SESUAI DENGAN ATAU MENURUT UNDANG-UNDANG.
slide249
PEJABAT TATA USAHA NEGARA
  • BADAN ATAU PEJABAT TATA USAHA NEGARA, YAITU BADAN ATAU PEJABAT YANG MELAKSANAKAN URUSAN PEMERINTAHAN BERDASARKAN PERATURAN PERUNDANG-UNDANGAN YANG BERLAKU PADA SAAT MELAKSANAKAN SUATU BIDANG URUSAN PEMERINTAHAN.
  • ATURAN HUKUM TERSEBUT TIDAK DITENTUKAN NAMA JABATAN YANG DAPAT DIKUALIFIKASIKAN SEBAGAI BADAN ATAU PEJABAT TATA USAHA NEGARA.
  • BAHWA YANG DIMAKSUD DENGAN URUSAN PEMERINTAHAN IALAH KEGIATAN YANG BERSIFAT EKSEKUTIF, DAN YANG DIMAKSUD DENGAN PEMERINTAH ADALAH KESELURUHAN KEGIATAN YANG MENJADI TUGAS DAN DILAKSANAKAN OLEH PARA BADAN DAN JABATAN (PEJABAT) TATA USAHA NEGARA (TUN) YANG BUKAN PEMBUATAN PERATURAN DAN MENGADILI.
slide250
PEJABAT PUBLIK

ALGEMEEN, OPENBAAR DAN PUBLIEK SENANTIASA MEMPUNYAI ARTI BERKAITAN DENGAN HUKUM ATAU MEMPUNYAI MAKNA HUKUM. BAHASA INDONESIA BELUM MEMPUNYAI ISTILAH YANG TEPAT UNTUK MENGARTIKAN ATAU MENGAKOMODIR KATA-KATA TERSEBUT. BAHASA INDONESIA HANYA MENGENAL KATA UMUM DAN PUBLIK. MESKIPUN DEMIKIAN AGAR TIDAK RANCU DALAM PENGGUNAANNYA, MAKA ISTILAH PUBLIK (DALAM BAHASA INDONESIA) HARUS DIARTIKAN SAMA SEBAGAIMANA ISTILAH PUBLIK (DALAM BAHASA BELANDA) YANG MEMPUNYAI MAKNA HUKUM, SEHINGGA PENGGUNAAN ISTILAH ATAU KATA PUBLIK HANYA UNTUK BADAN ATAU PEJABAT PEMERINTAH YANG DIPERLENGKAPI DENGAN KEKUASAAN ATAU KEWENANGAN DAN FUNGSI TERTENTU MENURUT ATURAN HUKUM UNTUK MELAYANI KEPENTINGAN MASYARAKAT, SEPERTI MEREKA YANG BEKERJA DI PEMERINTAHAN (EKSEKUTIF) DARI PUSAT SAMPAI DAERAH DISEBUT SEBAGAI PEJABAT PUBLIK.

slide251
SEBUTAN PEJABAT PUBLIK DAPAT DIBERIKAN KEPADA MEREKA YANG DALAM TUGASNYA BERFUNGSI UNTUK MELAYANI KEPENTINGAN UMUM SESUAI DENGAN KEWENANGANNYA. TIDAK HANYA KEPADA MEREKA YANG BERKEDUDUKAN SEBAGAI PEJABAT EKSEKUTIF SAJA,

TAPI JUGA KEPADA NOTARIS.

slide252
PEJABAT UMUMMENURUT KAMUS HUKUM SALAH SATU ARTI DARI AMBTENAREN ADALAH PEJABAT. DENGAN DEMIKIAN OPENBARE AMBTENAREN ADALAH PEJABAT YANG MEMPUNYAI TUGAS YANG BERTALIAN DENGAN KEPENTINGAN PUBLIK, SEHINGGA TEPAT JIKA OPENBARE AMBTENAREN DIARTIKAN SEBAGAI PEJABAT PUBLIK. KHUSUS BERKAITAN DENGAN OPENBAREAMBTENAREN YANG DITERJEMAHKAN SEBAGAI PEJABAT UMUM DIARTIKAN SEBAGAI PEJABAT YANG DISERAHI TUGAS UNTUK MEMBUAT AKTA OTENTIK YANG MELAYANI KEPENTINGAN PUBLIK, DAN KUALIFIKASI SEPERTI ITU DIBERIKAN KEPADA NOTARIS.
slide253
DENGAN DEMIKIAN PEJABAT UMUM MERUPAKAN SUATU JABATAN YANG DISANDANG ATAU DIBERIKAN KEPADA MEREKA YANG DIBERI WEWENANG OLEH ATURAN HUKUM DALAM PEMBUATAN AKTA OTENTIK, DAN NOTARIS SEBAGAI PEJABAT UMUM KEPADANYA DIBERIKAN KEWENANGAN UNTUK MEMBUAT AKTA OTENTIK. OLEH KARENA ITU NOTARIS SUDAH PASTI PEJABAT UMUM, TAPI PEJABAT UMUM BELUM TENTU NOTARIS, KARENA PEJABAT UMUM DAPAT DISANDANG PULA OLEH PEJABAT PEMBUAT AKTA TANAH (PPAT)

ATAU PEJABAT LELANG.

slide254
NOTARIS SEBAGAI PEJABAT PUBLIK

NOTARIS SEBAGAI PEJABAT PUBLIK, DALAM PENGERTIAN MEMPUNYAI WEWENANG DENGAN PENGECUALIAN. DENGAN MENGKATEGORIKAN NOTARIS SEBAGAI PEJABAT PUBLIK. DALAM HAL INI PUBLIK YANG BERMAKNA HUKUM, BUKAN PUBLIK SEBAGAI KHALAYAK UMUM. NOTARIS SEBAGAI PEJABAT PUBLIK TIDAK BERARTI SAMA DENGAN PEJABAT PUBLIK DALAM BIDANG PEMERINTAH YANG DIKATEGORIKAN SEBAGAI BADAN ATAU PEJABAT TATA USAHA NEGARA, HAL INI DAPAT DIBEDAKAN DARI PRODUK MASING-MASING PEJABAT PUBLIK TERSEBUT.

slide255
BERDASARKAN URAIAN DI ATAS, MAKA NOTARIS DALAM KATEGORI SEBAGAI PEJABAT PUBLIK YANG BUKAN PEJABAT TATA USAHA NEGARA, DENGAN WEWENANG YANG TERSEBUT DALAM ATURAN HUKUM YANG MENGATUR JABATAN NOTARIS, DALAM HAL INI SEBAGAIMANA TERCANTUM DALAM PASAL 15 UUJN.
slide256
JABATAN NOTARIS
  • JABATAN NOTARIS DIADAKAN ATAU KEHADIRANNYA DIKEHENDAKI OLEH ATURAN HUKUM DENGAN MAKSUD UNTUK MEMBANTU DAN MELAYANI MASYARAKAT YANG YANG MEMBUTUHKAN ALAT BUKTI TERTULIS YANG BERSIFAT OTENTIK MENGENAI KEADAAN, PERISTIWA ATAU PERBUATAN HUKUM. DENGAN DASAR SEPERTI INI MEREKA YANG DIANGKAT SEBAGAI NOTARIS HARUS MEMPUNYAI SEMANGAT UNTUK MELAYANI MASYARAKAT, DAN ATAS PELAYANAN TERSEBUT, MASYARAKAT YANG TELAH MERASA DILAYANI OLEH NOTARIS SESUAI DENGAN TUGAS JABATANNYA, DAPAT MEMBERIKAN HONORARIUM KEPADA NOTARIS. OLEH KARENA ITU NOTARIS TIDAK BERARTI APA-APA JIKA MASYARAKAT TIDAK MEMBUTUHKANNYA.
  • SECARA SUBSTANTIF AKTA NOTARIS DAPAT BERUPA :
  • SUATU KEADAAN, PERISTIWA ATAU PERBUATAN HUKUM YANG DIKEHENDAKI OLEH PARA PIHAK AGAR DITUANGKAN DALAM BENTUK AKTA OTENTIK UNTUK DIJADIKAN SEBAGAI ALAT BUKTI.
  • BERDASARKAN PERATURAN PERUNDANG-UNDANGAN BAHWA TINDAKAN HUKUM TERTENTU WAJIB DIBUAT DALAM BENTUK AKTA OTENTIK.
slide257
NOTARIS MERUPAKAN SUATU

JABATAN PUBLIK MEMPUNYAI KARATERISTIK,

YAITU:

1. SEBAGAI JABATAN.

2. NOTARIS MEMPUNYAI KEWENANGAN TERTENTU.

3. DIANGKAT DAN DIBERHENTIKAN OLEH PEMERINTAH.

(NOTARIS MESKIPUN SECARA ADMINISTRATIF DIANGKAT DAN

DIBERHENTIKAN OLEH PEMERINTAH, TIDAK BERARTI NOTARIS MENJADI SUBORDINASI (BAWAHAN) YANG MENGANGKATNYA PEMERINTAH. DENGAN DEMIKIAN NOTARIS DALAM MENJALANKAN TUGAS JABATANNYA :

- BERSIFAT MANDIRI (AUTONOMOUS),

- TIDAK MEMIHAK SIAPAPUN (IMPARTIAL),

- TIDAK TERGANTUNG KEPADA SIAPAPUN (INDEPENDENT)).

4. TIDAK MENERIMA GAJI ATAU PENSIUN DARI YANG MENGANGKATNYA.

5. AKUNTABILITAS ATAS PEKERJAANNYA KEPADA MASYARAKAT.

slide258
PERTANGGUNGJAWABAN NOTARIS, PEJABAT SEMENTARA NOTARIS, NOTARIS PENGGANTI DAN NOTARIS PENGGANTI KHUSUS

NOTARIS DALAM MENJALANKAN TUGAS JABATANNYA DIBATASI OLEH UMUR (BIOLOGIS) NOTARIS YANG BERSANGKUTAN, SEHINGGA DARI SEGI PERTANGGUNGJAWABANNYA TERHADAP AKTA YANG DIBUAT DI HADAPAN DAN OLEH NOTARIS, APAKAH PERTANGGUNGJAWABANNYA DIBATASI OLEH UMUR NOTARIS YANG BERSANGKUTAN ? ATAU OLEH AKTA ITU SENDIRI ?.

slide259
NOTARIS, NOTARIS PENGGANTI, PENJABAT SEMENTARA NOTARIS ATAU NOTARIS PENGGANTI KHUSUS MEMPUNYAI BATAS WAKTU DALAM MENJALANKAN TUGAS JABATANNYA. UNTUK NOTARIS SEBAGAIMANA TERSEBUT DALAM PASAL 8 AYAT (1) DAN (2) UUJN.
slide260
LEMBAGA NOTARIS  AGAR DAPAT BERJALAN, MAKA HARUS ADA PEJABAT YANG DAPAT MENJALANKANNYA, SEHINGGA UNTUK MENJALANKAN JABATAN NOTARIS DIANGKAT MEREKA YANG MEMENUHI SYARAT TERTENTU.
  • MEREKA (SUBJEK HUKUM ATAU ORANG) YANG DIANGKAT SEBAGAI NOTARIS MERUPAKAN PERSONIFIKASI DARI LEMBAGA NOTARIS.
  • PENGERTIAN JABATAN HARUS BERLANGSUNG TERUS-MENERUS (BERKESINAMBUNGAN) DAPAT DIBERLAKUKAN PADA NOTARIS, MESKIPUN SESEORANG SUDAH PENSIUN DARI JABATANNYA SEBAGAI NOTARIS, ATAU DENGAN BERHENTINYA SESEORANG SEBAGAI NOTARIS MAKA BERHENTI PULA KEDUDUKANNYA SEBAGAI NOTARIS, SEDANGKAN NOTARIS SEBAGAI JABATAN AKAN TETAP ADA DAN AKTA-AKTA YANG DIBUAT DI HADAPAN ATAU OLEH NOTARIS YANG SUDAH PENSIUN TERSEBUT AKAN TETAP DIAKUI DAN AKAN DISIMPAN (SEBAGAI SUATU KESINAMBUNGAN) OLEH NOTARIS PEMEGANG PROTOKOLNYA.
slide261
PRODUK DARI JABATAN NOTARIS (ANTARA LAIN) BERUPA AKTA. KETIKA SEORANG NOTARIS PENSIUN ATAU BERHENTI DARI JABATANNYA SEBAGAI NOTARIS, MAKA AKTA NOTARIS TERSEBUT HARUS DIPEGANG ATAU DISIMPAN OLEH NOTARIS LAINNYA SEBAGAI PEMEGANG PROTOKOL NOTARIS, DAN NOTARIS PEMEGANG PROTOKOL NOTARIS TERSEBUT TIDAK DAPAT MELAKUKAN TINDAKAN APAPUN, SEPERTI MERUBAH ISI AKTA, TAPI YANG DAPAT DILAKUKAN OLEH NOTARIS PEMEGANG PROTOKOL YAITU MERAWAT DAN MENGELUARKAN SALINAN ATAS PERMINTAAN PARA PIHAK YANG NAMANYA TERSEBUT DALAM AKTA ATAU PARA AHLI WARISNYA, SEHINGGA KESINAMBUNGANNYA DALAM PENYIMPANAN PROTOKOL NOTARIS BUKAN DALAM KESINAMBUNGAN PELAKSANAAN JABATAN OLEH PEJABAT, TAPI KESINAMBUNGAN JABATAN NOTARIS. DENGAN DEMIKIAN AKTA NOTARIS MEMPUNYAI UMUR YURIDIS, YAITU TETAP BERLAKU DAN MENGIKAT PARA PIHAK YANG NAMANYA TERCANTUM DALAM AKTA TERSEBUT, MESKIPUN NOTARIS YANG BERSANGKUTAN SUDAH BERHENTI MENJALANKAN TUGAS JABATANNYA SEBAGAI NOTARIS. MEREKA YANG MELAKSANAKAN TUGAS JABATAN NOTARIS DIBATASI OLEH UMUR BIOLOGIS. UMUR YURIDIS AKTA NOTARIS BISA SEPANJANG MASA – SEPANJANG ATURAN HUKUM YANG MENGATUR JABATAN NOTARIS TETAP ADA, DIBANDINGKAN DENGAN UMUR BIOLOGIS NOTARIS SENDIRI YANG AKAN BERAKHIR KARENA NOTARIS MENINGGAL DUNIA.
slide262
NOTARIS DALAM MENJALANKAN TUGAS JABATANNYA DIBATASI OLEH UMUR (BIOLOGIS) NOTARIS YANG BERSANGKUTAN, SEHINGGA DARI SEGI PERTANGGUNGJAWABANNYA TERHADAP AKTA YANG DIBUAT DI HADAPAN DAN OLEH NOTARIS, APAKAH PERTANGGUNGJAWABANNYA DIBATASI OLEH UMUR NOTARIS YANG BERSANGKUTAN ? ATAU OLEH AKTA ITU SENDIRI ?.
slide263
NOTARIS, NOTARIS PENGGANTI, PENJABAT SEMENTARA NOTARIS ATAU NOTARIS PENGGANTI KHUSUS MEMPUNYAI BATAS WAKTU DALAM MENJALANKAN TUGAS JABATANNYA.

UNTUK NOTARIS SEBAGAIMANA TERSEBUT DALAM PASAL 8 AYAT (1) DAN (2) UUJN.

slide264
BATAS UMUR ATAU KARENA ALASAN LAIN TERSEBUT TIDAK BERLAKU UNTUK PEJABAT SEMENTARA NOTARIS, NOTARIS PENGGANTI DAN NOTARIS PENGGANTI KHUSUS. HAL INI DIKAITKAN DENGAN PENGERTIAN PEJABAT SEMENTARA NOTARIS (PASAL 1 ANGKA 2), NOTARIS PENGGANTI (PASAL 1 ANGKA 3) DAN NOTARIS PENGGANTI KHUSUS (PASAL 1 ANGKA 4) UUJN.
slide265
PEJABAT SEMENTARA NOTARIS DAN NOTARIS PENGGANTI MELAKSANAKAN KEWENANGAN NOTARIS SERTA NOTARIS PENGGANTI KHUSUS (PASAL 33 AYAT (2) UUJN). PELAKSANAAN TUGAS JABATAN NOTARIS OLEH PEJABAT SEMENTARA NOTARIS, NOTARIS PENGGANTI DIBATASI OLEH WAKTU YANG DITENTUKAN DALAM SURAT KEPUTUSAN PENGANGKATANNYA. JIKA WAKTUNYA SUDAH SELESAI, MAKA PEJABAT SEMENTARA NOTARIS WAJIB MENYERAHKAN KEMBALI JABATAN DAN PROTOKOLNYA KEPADA NOTARIS YANG DITUNJUK OLEH MAJELIS PENGAWAS NOTARIS, DAN NOTARIS PENGGANTI WAJIB MENYERAHKAN KEMBALI JABATAN DAN PROTOKOLNYA KEPADA NOTARIS YANG DIGANTIKANNYA, SEDANGKAN NOTARIS PENGGANTI KHUSUS HANYA UNTUK AKTA TERTENTU SAJA SESUAI DENGAN YANG TERCANTUM DALAM SURAT KEPUTUSANNYA. DENGAN DEMIKIAN PEJABAT SEMENTARA NOTARIS, NOTARIS PENGGANTI DAN NOTARIS PENGGANTI KHUSUS DALAM MELAKSANAKAN TUGAS JABATANNYA BERSIFATSEMENTARA SAJA.
slide266
BATAS KEWENANGAN NOTARIS, PEJABAT SEMENTARA NOTARIS, NOTARIS PENGGANTI DAN NOTARIS PENGGANTI KHUSUS BERBEDA. BATAS KEWENANGAN PEJABAT SEMENTARA NOTARIS DAN NOTARIS PENGGANTI BERAKHIR KETIKA BATAS YANG TERCANTUM DALAM SURAT KEPUTUSANNYA TELAH HABIS, DAN NOTARIS PENGGANTI KHUSUS BERAKHIR KETIKA AKTA YANG WAJIB DIBUATNYA SESUAI SURAT KEPUTUSANNYA SELESAI DIBUAT.
slide267
KETIKA SEORANG NOTARIS PENSIUN ATAU DIBERHENTIKAN SEBAGAI NOTARIS, DAN PEJABAT SEMENTARA NOTARIS, NOTARIS PENGGANTI SUDAH SELESAI MELAKSANAKAN TUGAS JABATANNYA SESUAI DENGAN KEPUTUSANNYA PENGANGKATANNYA, DAN NOTARIS PENGGANTI KHUSUS TELAH MEMBUAT AKTA YANG WAJIB DIBUAT SESUAI YANG TERCANTUM DALAM SURAT KEPUTUSAN PENGANGKATANNYA, MAKA TELAH SELESAI PULA PERTANGGUNGJABAWAN MEREKA DALAM MELAKSANAKAN TUGAS JABATANNYA.
slide268
ADA KERANCUAN MENGENAI BATAS PERTANGGUNGJAWABAN NOTARIS, NOTARIS PENGGANTI, NOTARIS PENGGANTI KHUSUS DAN PEJABAT SEMENTARA NOTARIS BERDASARKAN PASAL 65 UUJN, YAITU MESKIPUN SEMUA AKTA YANG DIBUAT OLEH NOTARIS, NOTARIS PENGGANTI, NOTARIS PENGGANTI KHUSUS, DAN PEJABAT SEMENTARA NOTARIS TELAH DISERAHKAN ATAU DIPINDAHKAN KEPADA PIHAK PENYIMPAN PROTOKOL NOTARIS, HAL INI BERARTI MESKIPUN SUDAH BERHENTI ATAU PENSIUN SEBAGAI NOTARIS, NOTARIS PENGGANTI, NOTARIS PENGGANTI KHUSUS DAN PEJABAT SEMENTARA MASIH HARUS BERTANGGUNGJAWAB JAWAB SAMPAI HEMBUSAN NAFAS TERAKHIR…???????.
slide269
SEHINGGA YANG LOGIS YAITU JIKA SEORANG NOTARIS, NOTARIS PENGGANTI, NOTARIS PENGGANTI KHUSUS DAN PEJABAT SEMENTARA NOTARIS SUDAH TIDAK MENJABAT LAGI MESKIPUN YANG BERSANGKUTAN MASIH HIDUP TIDAK DAPAT DIMINTA LAGI PERTANGGUNGJAWABANNYA DALAM BENTUK APAPUN, DAN NOTARIS PENYIMPAN PROTOKOL WAJIB MEMPERLIHATKAN ATAU MEMBERIKAN FOTOKOPI DARI MINUTA AKTA YANG DIKETAHUI SESUAI DENGAN ASLINYA OLEH NOTARIS PENYIMPAN PROTOKOL ATAU OLEH MAJELIS PENGAWAS DAERAH (MPD) UNTUK PROTOKOL NOTARIS YANG TELAH BERUMUR 25 (DUA PULUH LIMA) TAHUN ATAU LEBIH (PASAL 63 AYAT (5) UUNJ). BERDASARKAN PENGERTIAN SEPERTI ITU, KEBERADAAN PASAL 65 UUJN TERSEBUT TIDAK SESUAI DENGAN MAKNA BAHWA AKTA NOTARIS SEBAGAI AKTA OTENTIK YANG MEMPUNYAI NILAI PEMBUKTIAN YANG SEMPURNA.
slide270
BATAS PERTANGGUNGJAWABAN NOTARIS, PEJABAT SEMENTARA NOTARIS, NOTARIS PENGGANTI DAN NOTARIS PENGGANTI KHUSUS DAPAT DIMINTA SEPANJANG MEREKA MASIH BERWENANG DALAM MELAKSANAKAN TUGAS JABATAN SEBAGAI NOTARIS, ATAU KESALAHAN-KESALAHAN YANG DILAKUKAN DALAM MENJALANKAN TUGAS JABATAN SEBAGAI NOTARIS DAN SANKSI-SANKSI YANG DAPAT DIKENAKAN TERHADAP NOTARIS DAPAT DIJATUHKAN SEPANJANG NOTARIS, PEJABAT SEMENTARA NOTARIS, NOTARIS PENGGANTI DAN NOTARIS PENGGANTI KHUSUS MASIH BERWENANG UNTUK MELAKSANAKAN TUGAS JABATAN SEBAGAI NOTARIS. DENGAN KONTRUKSI PERTANGGUNGJAWABAN SEPERTI TERSEBUT DI ATAS, TIDAK AKAN ADA LAGI NOTARIS, NOTARIS PENGGANTI, PENJABAT SEMENTARA NOTARIS ATAU NOTARIS PENGGANTI KHUSUS DIMINTA PERTANGUNGJAWABANNYA LAGI SETELAH YANG BERSANGKUTAN BERHENTI ATAU DARI TUGAS JABATANNYA SEBAGAI NOTARIS.
slide271
PENYIMPANAN PROTOKOL NOTARIS OLEH NOTARIS PEMEGANG PROTOKOL MERUPAKAN SUATAU UPAYA UNTUK MENJAGA UMUR YURIDIS AKTA NOTARIS SEBAGAI ALAT BUKTI YANG SEMPURNA BAGI PARA PIHAK ATAU AHLI WARISNYA TENTANG SEGALA HAL YANG TERMUAT DI DALAM AKTA TERSEBUT. AKTA NOTARIS DALAM BENTUK SALINAN AKAN SELAMANYA ADA JIKA DISIMPAN OLEH YANG BERSANGKUTAN, DAN DALAM BENTUK MINUTA JUGA AKAN SELAMANYA ADA YANG DISIMPAN OLEH NOTARIS SENDIRI ATAU OLEH NOTARIS PEMEGANG PROTOKOL ATAU OLEH MAJELIS PENGAWAS DAERAH. NOTARIS MENINGGAL DUNIA, TAPI AKTA NOTARIS AKAN TETAP ADA YANG MEMPUNYAI UMUR YURIDIS, DAN MELEBIHI UMUR BIOLOGIS NOTARIS SENDIRI.
slide272
DENGAN DEMIKIAN PERTANGGUNGJAWABAN NOTARIS, NOTARIS PENGGANTI, NOTARIS PENGGANTI KHUSUS, DAN PEJABAT SEMENTARA NOTARIS SEPANJANG MASIH MEMPUNYAI WEWENANG UNTUK MENJALANKAN TUGAS JABATAN SEBAGAI NOTARIS.
kuliah 08

KULIAH 08

KARAKTER YURIDIS AKTA NOTARIS

slide274
1. AKTA NOTARIS SEBAGAI ALAT BUKTI TERTULIS 2. SYARAT AKTA NOTARIS SEBAGAI AKTA OTENTIK 3. NILAI PEMBUKTIAN AKTA OTENTIK :3.1. LAHIRIAH (UITWENDIGE BEWIJSKRACHT) 3.2. FORMAL (FORMELE BEWIJSKRACHT)3.3. MATERIL (MATERIL BEWIJSKRACHT4. NILAI PEMBUKTIAN AKTA DALAM PUTUSAN PENGADILAN5. ASAS PRADUGA SAH DALAM MENILAI AKTA NOTARIS6. ASAS-ASAS PELAKSANAAN TUGAS JABATAN NOTARIS YANG BAIK
slide275
1. AKTA NOTARIS SEBAGAI ALAT BUKTI TERTULIS AKTA NOTARIS MERUPAKAN PERJANJIAN PARA PIHAK YANG MENGIKAT MEREKA MEMBUATNYA, OLEH KARENA ITU SYARAT-SYARAT SAHNYA SUATU PERJANJIAN HARUS DIPENUHI. PASAL 1320 BW YANG MENGATUR TENTANG SYARAT SAHNYA PERJANJIAN, ADA SYARAT SUBJEKTIF YAITU SYARAT YANG BERKAITAN DENGAN SUBJEK YANG MENGADAKAN ATAU MEMBUAT PERJANJIAN, YANG TERDIRI DARI KATA SEPAKAT DAN CAKAP BERTINDAK UNTUK MELAKUKAN SUATU PERBUATAN HUKUM, DAN SYARAT OBJEKTIF YAITU SYARAT YANG BERKAITAN DENGAN PERJANJIAN ITU SENDIRI ATAU BERKAITAN DENGAN OBJEK YANG DIJADIKAN PERBUATAN HUKUM OLEH PARA PIHAK, YANG TERDIRI DARI SUATU HAL TERTENTU DAN SEBAB YANG TIDAK DILARANG.
slide276
2. SYARAT AKTA NOTARIS SEBAGAI AKTA OTENTIK.PASAL 1868 B.W. MERUPAKAN SUMBER UNTUK OTENSITAS AKTA NOTARIS JUGA MERUPAKAN DASAR LEGALITAS EKSISTENSI AKTA NOTARIS, DENGAN SYARAT-SYARAT SEBAGAI BERIKUT :1. AKTA ITU HARUS DIBUAT OLEH (DOOR) ATAU DI HADAPAN (TEN OVERSTAAN)SEORANG PEJABAT UMUM.2. AKTA ITU HARUS DIBUAT DALAM BENTUK YANG DITENTUKAN OLEH UNDANG-UNDANG,3. PEJABAT UMUM OLEH – ATAU DI HADAPAN SIAPA AKTA ITU DIBUAT, HARUS MEMPUNYAI WEWENANG UNTUK MEMBUAT AKTA TERSEBUT.
slide277
KARAKTER YURIDIS AKTA NOTARIS, YAITU :1. AKTA NOTARIS WAJIB DIBUAT DALAM BENTUK YANG SUDAH DITENTUKAN OLEH UNDANG-UNDANG (UUJN).2. AKTA NOTARIS DIBUAT KARENA ADA PERMINTAAN PARA PIHAK, DAN BUKAN KEINGINAN NOTARIS;3. MESKIPUN DALAM AKTA NOTARIS TERCANTUM NAMA NOTARIS, TAPI DALAM HAL INI NOTARIS TIDAK BERKEDUDUKAN SEBAGAI PIHAK BERSAMA-SAMA PARA PIHAK ATAU PENGHADAP YANG NAMANYA TERCANTUM DALAM AKTA.4. MEMPUNYAI KEKUATAN PEMBUKTIAN YANG SEMPURNA. SIAPAPUN TERIKAT DENGAN AKTA NOTARIS SERTA TIDAK DAPAT DITAFSIRKAN LAIN, SELAIN YANG TERCANTUM DALAM AKTA TERSEBUT.5. PEMBATALAN DAYA IKAT AKTA NOTARIS HANYA DAPAT DILAKUKAN ATAS KESEPAKATAN PARA PIHAK YANG NAMANYA TERCANTUM DALAM AKTA. JIKA ADA YANG TIDAK SETUJU, MAKA PIHAK YANG TIDAK SETUJU HARUS MENGAJUKAN PERMOHONAN KE PENGADILAN UMUM AGAR AKTA YANG BERSANGKUTAN TIDAK MENGIKAT LAGI DENGAN ALASAN-ALASAN TERTENTU YANG DAPAT DIBUKTIKAN.
slide278
3. NILAI PEMBUKTIAN AKTA OTENTIK :3.1. LAHIRIAH (UITWENDIGE BEWIJSKRACHT)KEMAMPUAN LAHIRIAH AKTA NOTARIS, MERUPAKAN KEMAMPUAN AKTA ITU SENDIRI UNTUK MEMBUKTIKAN KEABSAHANNYA SEBAGAI AKTA OTENTIK (ACTA PUBLICA PROBANT SESE IPSA). JIKA DILIHAT DARI LUAR (LAHIRNYA) SEBAGAI AKTA OTENTIK SERTA SESUAI DENGAN ATURAN HUKUM YANG SUDAH DITENTUKAN MENGENAI SYARAT AKTA OTENTIK, MAKA AKTA TERSEBUT BERLAKU SEBAGAI AKTA OTENTIK, SAMPAI TERBUKTI SEBALIKNYA, ARTINYA SAMPAI ADA YANG MEMBUKTIKAN BAHWA AKTA TERSEBUT BUKAN AKTA OTENTIK SECARA LAHIRIAH. DALAM HAL INI BEBAN PEMBUKTIAN ADA PIHAK YANG MENYANGKALNYA KEOTENTIKAN AKTA NOTARIS. PARAMETER UNTUK MENENTUKAN AKTA NOTARIS SEBAGAI AKTA OTENTIK, YAITU TANDA TANGAN DARI NOTARIS YANG BERSANGKUTAN, BAIK YANG ADA PADA MINUTA DAN SALINAN DAN ADANYA AWAL AKTA (MULAI DARI JUDUL) SAMPAI DENGAN AKHIR AKTA.
slide279
3.2. FORMAL (FORMELE BEWIJSKRACHT)AKTA NOTARIS HARUS MEMBERIKAN KEPASTIAN BAHWA SESUATU KEJADIAN DAN FAKTA TERSEBUT DALAM AKTA BETUL-BETUL DILAKUKAN OLEH NOTARIS ATAU DITERANGKAN OLEH PIHAK-PIHAK YANG MENGHADAP PADA SAAT YANG TERCANTUM DALAM AKTA SESUAI DENGANPROSEDUR YANG SUDAH DITENTUKAN DALAM DALAM PEMBUATAN AKTA. SECARA FORMAL UNTUK MEMBUKTIKAN KEBENARAN DAN KEPASTIAN TENTANG HARI, TANGGAL, BULAN, TAHUN, PUKUL (WAKTU) MENGHADAP, DAN PARA PIHAK YANG MENGHADAP, PARAF DAN TANDA TANGAN PARA PIHAK/PENGHADAP, SAKSI DAN NOTARIS, SERTA MEMBUKTIKAN APA YANG DILIHAT, DISAKSIKAN, DIDENGAR OLEH NOTARIS (PADA AKTA PEJABAT/BERITA ACARA), DAN MENCATATKAN KETERANGAN ATAU PERNYATAAN PARA PIHAK/PENGHADAP (PADA AKTA PIHAK).
slide280
3.3. MATERIL (MATERIL BEWIJSKRACHT)MERUPAKAN KEPASTIAN TENTANG MATERI SUATU AKTA, BAHWA APA YANG TERSEBUT DALAM AKTA MERUPAKAN PEMBUKTIAN YANG SAH TERHADAP PIHAK-PIHAK YANG MEMBUAT AKTA ATAU MEREKA YANG MENDAPAT HAK DAN BERLAKU UNTUK UMUM, KECUALI ADA PEMBUKTIAN SEBALIKNYA (TEGENBEWIJS). KETERANGAN ATAU PERNYATAAN YANG DITUANGKAN/DIMUAT DALAM AKTA PEJABAT (ATAU BERITA ACARA), ATAU KETERANGAN ATAU PARA PIHAK YANG DIBERIKAN/DISAMPAIKAN DI HADAPAN NOTARIS (AKTA PIHAK) DAN PARA PIHAK HARUS DINILAI BENAR BERKATA YANG KEMUDIAN DITUANGKAN/DIMUAT DALAM AKTA BERLAKU SEBAGAI YANG BENAR ATAU SETIAP ORANG YANG DATANG MENGHADAP NOTARIS YANG KEMUDIAN/KETERANGANNYA DITUANGKAN/DIMUAT DALAM AKTA HARUS DINILAI TELAH BENAR BERKATA, JIKA TERNYATA PERNYATAAN/KETERANGAN PARA PENGHADAP TERSEBUT MENJADI TIDAK BENAR BERKATA, MAKA HAL TERSEBUT TANGGUNGJAWAB PARA PIHAK SENDIRI. NOTARIS TERLEPAS DARI HAL SEMACAM ITU. DENGAN DEMIKIAN ISI AKTA NOTARIS MEMPUNYAI KEPASTIAN SEBAGAI YANG SEBENARNYA, MENJADI BUKTI YANG SAH UNTUK/DIANTARA PARA PIHAK DAN PARA AHLI WARIS SERTA PARA PENERIMA HAK MEREKA.
slide281
4. NILAI PEMBUKTIAN AKTA DALAM PUTUSAN PENGADILANPEMERIKSAAN TERHADAP NOTARIS SELAKU TERSANGKA ATAU TERDAKWA HARUS DIDASARKAN KEPADA TATA CARA PEMBUATAN AKTA NOTARIS, YAITU :1. MELAKUKAN PENGENALAN TERHADAP PENGHADAP, BERDASARKAN IDENTITASNYA YANG DIPERLIHATKAN KEPADA NOTARIS;2. MENANYAKAN, KEMUDIAN MENDENGARKAN DAN MENCERMATI KEINGINAN ATAU KEHENDAK PARA PIHAK TERSEBUT (TANYA – JAWAB).3. MEMERIKSA BUKTI SURAT YANG BERKAITAN DENGAN KEINGINAN ATAU KEHENDAK PARA PIHAK TERSEBUT.4. MEMBERIKAN SARAN DAN MEMBUAT KERANGKA AKTA UNTUK MEMENUHI KEINGINAN ATAU KEHENDAK PARA PIHAK TERSEBUT.5. MEMENUHI SEGALA TEKNIK ADMINISTRATIF PEMBUATAN AKTA NOTARIS, SEPERTI PEMBACAAN, PENANDATATANGANAN, 6. MEMBERIKAN SALINAN, DAN PEMBERKASAN UNTUK MINUTA.MELAKUKAN KEWAJIBAN LAIN YANG BERKAITAN DENGAN PELAKSANAAN TUGAS JABATAN NOTARIS.
slide282
DALAM MEMERIKSA NOTARIS YANG BERKAITAN DENGAN AKTA YANG DIBUAT ATAU DIBUAT OLEH NOTARIS YANG BERSANGKUTAN, PARAMETERNYA HARUS KEPADA PROSEDUR PEMBUATAN AKTA NOTARIS, DALAM HAL INI UUJN. JIKA SEMUA PROSEDUR SUDAH DILAKUKAN, MAKA AKTA YANG BERSANGKUTAN TETAP MENGIKAT MEREKA YANG MEMBUATNYA DI HADAPAN NOTARIS.
slide283
5. ASAS PRADUGA SAH DALAM MENILAI AKTA NOTARISASAS INI DAPAT DIPERGUNAKAN UNTUK MENILAI AKTA NOTARIS, YAITU AKTA NOTARIS HARUS DIANGGAP SAH SAMPAI ADA PIHAK YANG MENYATAKAN AKTA TERSEBUT TIDAK SAH. UNTUK MENYATAKAN ATAU MENILAI AKTA TERSEBUT TIDAK SAH HARUS DENGAN GUGATAN KE PENGADILAN UMUM. SELAMA DAN SEPANJANG GUGATAN BERJALAN SAMPAI DENGAN ADA KEPUTUSAN PENGADILAN YANG MEMPUNYAI KEKUATAN HUKUM TETAP, MAKA AKTA NOTARIS TETAP SAH DAN MENGIKAT PARA PIHAK ATAU SIAPA SAJA YANG BERKEPENTINGAN DENGAN AKTA TERSEBUT.
slide284
ASAS PRADUGA SAH INI BERKAITAN DENGAN AKTA YANG DAPAT DIBATALKAN, MERUPAKAN SUATU TINDAKAN MENGANDUNG CACAT, YAITU TIDAK BERWENANGNYA NOTARIS UNTUK MEMBUAT AKTA SECARA LAHIRIAH, FORMAL, MATERIL, DAN TIDAK SESUAI DENGAN ATURAN HUKUM TENTANG PEMBUATAN AKTA NOTARIS. DAN ASAS INI TIDAK DAPAT DIPERGUNAKAN UNTUK MENILAI AKTA BATAL DEMI HUKUM, KARENA AKTA BATAL DEMI HUKUM DIANGGAP TIDAK PERNAH DIBUAT.
slide285
MESKIPUN DEMIKIAN KEDUDUKAN AKTA NOTARIS TELAH :1. DIAJUKAN PEMBATALAN OLEH PIHAK YANG BERKEPENTINGAN KEPADA PENGADILAN UMUM (NEGERI) DAN TELAH ADA PUTUSAN PENGADILAN UMUM YANG TELAH MEMPUNYAI KEKUATAN HUKUM TETAP, ATAU2. BATAL DEMI HUKUM, ATAU 3. MEMPUNYAI KEKUATAN PEMBUKTIAN SEBAGAI AKTA DIBAWAH TANGAN, ATAU4. DIBATALKAN OLEH PARA PIHAK SENDIRI, ATAU5. DIBATALKAN OLEH PUTUSAN PENGADILAN YANG TELAH MEMPUNYAI KEKUATAN HUKUM TETAP KARENA PENERAPAN ASAS PRADUGA SAH.MAKA MINUTA AKTA-AKTA TERSEBUT TETAP HARUS BERADA DALAM BUNDEL AKTA NOTARIS YANG BERSANGKUTAN, DAN NOTARIS YANG BERSANGKUTAN ATAUPUN PEMEGANG PROTOKOLNYA MASIH TETAP BERWENANG UNTUK MENGELUARKAN SALINANNYA ATAS PERMOHONAN PARA PIHAK ATAU PARA AHLI WARISNYA YANG BERKEPENTINGAN. PEMBERIAN SALINAN TERSEBUT DILAKUKAN OLEH NOTARIS, KARENA AKTA NOTARIS TERSEBUT MERUPAKAN PERBUATAN PARA PIHAK, DAN PARA PIHAK BERHAK ATAS SALINAN AKTA NOTARIS DAN NOTARIS BERKEWAJIBAN UNTUK MEMBUAT DAN MEMBERIKAN SALINANNYA.
slide286
ASAS-ASAS PELAKSANAAN TUGAS JABATAN NOTARIS YANG BAIK1. ASAS PERSAMAAN;2. ASAS KEPERCAYAAN;3. ASAS KEPASTIAN HUKUM;4. ASAS KECERMATAN;5. ASAS PEMBERIAN ALASAN;5. LARANGAN PENYALAHGUNAAN WEWENANG;6. LARANGAN BERTINDAK SEWENANG-WENANG.6. ASAS PROPORSIONALITAS 7. ASAS PROFESIONALITAS
slide287
1. Asas persamaan;

Pada awal kehadiran Notaris di Indonesia, sekitar tahun 1620 dengan kewenangan yang terbatas dan hanya untuk melayani golongan penduduk tertentu atau untuk melyani mereka yang bertransaksi dengan pihak Vereenigde Oost Ind. Compagnie (V.O.C) dan pada masa pemerintah Hindia-Belanda, Notaris pernah diberi kewenangan untuk membuat akta peralihan untuk bidang tanah yang tunduk kepada ketentuan-ketentuan BW, untuk tanah-tanah yang terdaftar, dan untuk peralihan haknya harus dilakukan dan didaftar pada pejabat-pejabatyang disebut Pejabat-pejabat Balik Nama (Overschrijving-ambtenaren) S.1834 - 27.

slide288
Sesuai dengan perkembangan jaman, institusi Notaris telah menjadi bagian dari masyarakat Indonesia, dan dengan lahirnya UUJN semakin meneguhkan institusi Notaris. Dalam memberikan pelayanan kepada masyarakat tidak membedakan-bedakan satu dengan yang lainnya berdasarkan keadaan sosial-ekonomi atau alasan lainnya. Alasan-alasan seperti ini tidak dibenarkan untuk dilakukan oleh Notaris dalam melayani masyarakat, hanya alasan hukum yang dapat dijadikan dasar bahwa Notaris dapat tidak memberikan jasa kepada yang menghadap Notaris. Bahkan dalam keadaan tertentu Notaris wajib memberikan jasa hukum di bidang kenotariatan secara cuma-cuma kepada yang tidak mampu (Pasal 37 UUJN).
slide289
2. Asas kepercayaan;

Jabatan Notaris merupakan jabatan kepercayaan yang harus selaras dengan mereka yang menjalankan tugas jabatan Notaris sebagai orang yang dapat dipercaya. Notaris sebagai jabatan kepercayaan tidak berarti apa-apa, jika ternyata mereka yang menjalankan tugas jabatan sebagai Notaris sebagai orang yang tidak dapat dipercaya, sehingga hal tersebut, antara Jabatan Notaris dan Pejabatnya (yang menjalankan tugas Jabatan Notaris) harus sejalan bagaikan dua sisi mata uang yang tidak dapat dipisahkah.

slide290
Salah satu bentuk dari Notaris sebagai jabatan kepercayaan, maka Notaris mempunyai kewajiban untuk merahasiakan segala sesuatu mengenai akta yang dibuatnya dan segala keterangan yang diperoleh guna pembuatan akta sesuai dengan sumpah/janji jabatan, kecuali undang-undang menentukan lain (Pasal 16 ayat (1) huruf f UUJN). Berkaitan dengan Pasal 16 ayat (1) huruf f UUJN merupakan kelengkapan kepada Notaris dalam menjalankan tugas jabatannya sebagai Kewajiban Ingkar (Verschoningsplicht) Notaris.
slide291
Pelaksanaan Notaris sebagai jabatan kepercayaan dimulai ketika calon Notaris disumpah atau mengucapkan janji (berdasarkan agama masing-masing) sebagai Notaris. Sumpah atau janji sebagai Notaris mengandung makna yang sangat dalam yang harus dijalankan dan mengikat selama menjalankan tugas jabatan sebagai Notaris.
  • Sumpah atau janji tersebut mengandung dua hal yang harus dipahami, yaitu
slide292
(1) Notaris wajib bertanggungjawab kepada Tuhan, karena sumpah atau janji yang diucapkan berdasarkan agama masing-masing, dengan demikian artinya segala sesuatu yang dilakukan Notaris dalam menjalankan tugas jabatannya akan diminta pertanggungjawabannya dalam bentuk yang dikehendaki Tuhan;
slide293
(2) Notaris wajib bertanggungjawab kepada negara dan masyarakat, artinya Negara telah memberi kepercayaan untuk menjalankan sebagai tugas Negara dalam bidang Hukum Perdata, yaitu dalam pembuatan alat bukti berupa akta yang mempunyai kekuatan pembuktian sempurna, dan kepada masyarakat yang telah percaya bahwa Notaris mampu memformulasikan kehendaknya ke dalam bentuk akta Notaris, dan percaya bahwa Notaris mampu menyimpan (merahasiakan) segala keterangan atau ucapan yang diberikan di hadapan Notaris.
slide294
Dalam Pasal 4 ayat (2) UUJN mengenai sumpah/janji Notaris ditegaskan……”bahwa saya akan merahasiakan isi akta dan keterangan yang diperoleh dalam pelaksanaan jabatan saya…”, dan Pasal 16 ayat (1) huruf e UUJN, bahwa Notaris berkewajiban - “merahasiakan segala sesuatu mengenai akta yang dibuatnya dan segala keterangan yang diperoleh guna pembuatan akta sesuai dengan sumpah/janji jabatan, kecuali undang-undang menentukan lain”.
slide295
Secara umum Notaris wajib merahasiakan isi akta dan keterangan yang diperoleh dalam pembuatan akta Notaris, kecuali diperintahkan oleh undang-undang bahwa Notaris tidak wajib merahasiakan dan memberikan keterangan yang diperlukan yang berkaitan dengan akta tersebut, dengan demikian batasannya hanya undang-undang saja yang dapat memerintahkan Notaris untuk membuka rahasia isi akta dan keterangan/pernyataan yang diketahui Notaris yang berkaitan dengan pembuatan akta yang dimaksud.
slide296
Bahwa instrument untuk ingkar bagi Notaris ditegaskan sebagai salah satu kewajiban Notaris yang tersebut dalam Pasal 16 ayat (1) huruf e UUJN, sehingga Kewajiban Ingkar untuk Notaris melekat pada tugas jabatan Notaris. Sebagai suatu kewajiban harus dilakukan, berbeda dengan hak ingkar, yang dapat dipergunakan atau tidak dipergunakan, tapi kewajiban ingkar mutlak dilakukan dan dijalankan oleh Notaris, kecuali ada undang-undang yang memerintahkan untuk menggugurkan kewajiban ingkar tersebut.
slide297
Dalam hal ini timbul pertanyaan, kapan kewajiban ingkar dapat dilakukan ? Kewajiban ingkar dapat dilakukan dengan batasan sepanjang Notaris diperiksa oleh instansi mana saja yang berupaya untuk meminta pernyataan atau keterangan dari Notaris yang berkaitan dengan akta yang telah atau pernah dibuat oleh atau di hadapan Notaris yang bersangkutan.
slide298
Notaris sebagai jabatan kepercayaan wajib untuk menyimpan rahasia mengenai akta yang dibuatnya dan keterangan/ pernyataan para pihak yang diperoleh dalam pembuatan akta, kecuali undang-undang memerintahkannya untuk membuka rahasia dan memberikan keterangan/pernyatan tersebut kepada pihak yang memintanya. Tindakan seperti ini merupakan suatu kewajiban Notaris berdasarkan ketentuan Pasal 4 ayat (2) UUJN dan Pasal 16 ayat (1) huruf e UUUJN. Jika ternyata Notaris sebagai saksi atau tersangka, tergugat ataupun dalam pemeriksaan oleh Majelis Pengawas Notaris membuka rahasia dan memberikan keterangan/pernyataan yang seharusnya wajib dirahasiakan, sedangkan undang-undang tidak memerintahkannya, maka atas pengaduan pihak yang merasa dirugikan kepada pihak yang berwajib dapat diambil tindakan terhadap Notaris tersebut, tindakan Notaris seperti ini dapat dikenakan Pasal 322 ayat (1) dan (2) KUHP, yaitu membongkar rahasia, padahal Notaris berkewajiban untuk menyimpannya. Dalam kedudukan sebagai saksi (perkara perdata) Notaris dapat minta dibebaskan dari kewajibannya untuk memberikan kesaksian, karena jabatannya menurut undang-undang diwajibkan untuk merahasiakannya (Pasal 1909 ayat (3) BW).
slide299
Notaris mempunyai Kewajiban Ingkar bukan untuk kepentingan diri Notaris, tapi untuk kepentingan para pihak yang telah mempercayakan kepada Notaris, bahwa Notaris dipercaya oleh para pihak mampu menyimpan semua keterangan atau pernyataan para pihak yang pernah diberikan di hadapan Notaris yang berkaitan dalam pembuatan akta.
slide300
3. Asas kepastian hukum.

Notaris dalam menjalankan tugas jabatannya wajib berpedoman secara normatif kepada aturan hukum yang berkaitan dengan segala tindakan yang akan diambil untuk kemudian dituangkan dalam akta. Bertindak berdasarkan aturan hukum yang berlaku akan memberikan kepastian kepada para pihak, bahwa akta yang dibuat di hadapan atau oleh Notaris telah sesuai dengan aturan hukum yang berlaku, sehingga jika terjadi permasalahan, akta Notaris dapat dijadikan pedoman oleh para pihak.

slide301
4. Asas kecermatan;

Notaris dalam mengambil suatu tindakan harus dipersiapkan dan didasarkan pada aturan hukum yang berlaku. Meneliti semua bukti yang diperlihatkan kepada Notaris dan mendengarkan keterangan atau pernyataan para pihak wajib dilakukan sebagai bahan dasar untuk dituangkan dalam akta. Asas kecermatan ini merupakan penerapan dari Pasal 16 ayat (1) huruf a, antara lain dalam menjalankan tugas jabatannya wajib bertindak seksama.

slide302
Pelaksanaan asas kecermatan wajib dilakukan dalam pembuatan akta ini dengan :
    • melakukan pengenalan terhadap penghadap, berdasarkan identitasnya yang diperlihatkan kepada Notaris;
    • menanyakan, kemudian mendengarkan dan mencermati keinginan atau kehendak para pihak tersebut (tanya – jawab).
    • memeriksa bukti surat yang berkaitan dengan keinginan atau kehendak para pihak tersebut.
slide303
memberikan saran dan membuat kerangka akta untuk memenuhi keinginan atau kehendak para pihak tersebut.
  • memenuhi segala teknik administratif pembuatan akta Notaris, seperti pembacaan, penandatatanganan, memberikan salinan, dan pemberkasan untuk minuta.
  • melakukan kewajiban lain yang berkaitan dengan pelaksanaan tugas jabatan Notaris.
slide304
5. Asas pemberian alasan.

Setiap akta yang dibuat di hadapan atau oleh Notaris harus mempunyai alasan dan fakta yang mendukung untuk akta yang bersangkutan atau ada pertimbangan hukum yang harus dijelaskan kepada para pihak/penghadap.

slide305
6. Larangan penyalahgunaan wewenang;

Pasal 15 UUJN merupakan batas kewenangan Notaris dalam menjalankan tugas jabatannya. Penyalahgunaan wewenang yaitu suatu tindakan yang dilakukan oleh Notaris diluar dari wewenang yang telah ditentukan. Jika Notaris membuat suatu tindakan diluar wewenang yang telah ditentukan, maka tindakan Notaris dapat disebut sebagai tindakan penyalahgunaan wewenang. Jika tindakan seperti merugikan para pihak, maka para pihak yang merasa dirugikan dapat menuntut Notaris yang bersangkutan dengan kualifikasi sebagai suatu tindakan hukum yang merugikan para pihak. Para pihak yang menderita kerugian untuk menuntut penggantian biaya, ganti rugi dan bunga kepada Notaris.

slide306
7. Larangan bertindak sewenang-wenang.

Notaris dalam menjalankan tugas jabatannya dapat menentukan, tindakan para pihak dapat dituangkan dalam bentuk akta Notaris atau tidak. Sebelum sampai pada keputusan seperti itu, Notaris harus mempertimbangkan dan melihat semua dokumen yang diperlihatkan kepada Notaris. Dalam hal ini Notaris mempunyai peranan untuk menentukan suatu tindakan dapat dituangkan dalam bentuk akta atau tidak, dan keputusan yang diambil harus didasarkan pada alasan hukum yang harus dijelaskan kepada para pihak.

slide307
8. Asas Proporsionalitas.
  • Dalam Pasal 16 ayat (1) huruf a, Notaris dalam menjalankan tugas jabatannya wajib bertindak menjaga kepentingan para pihak yang terkait dalam perbuatan hukum atau dalam menjalankan tugas jabatan Notaris, wajib mengutamakan adanya keseimbangan antara hak dan kewajiban para pihak yang menghadap Notaris.
  • Notaris dituntut untuk senantiasa mendengar dan mempertimbangkan keinginan para pihak agar tindakannya dituangkan dalam akta Notaris, sehingga kepentingan para pihak terjaga secara proporsional yang kemudian dituangkan ke dalam bentuk akta Notaris.
slide308
9. Asas Profesionalitas

Dalam Pasal 16 ayat (1) huruf d, Notaris wajib memberikan pelayanan sesuai dengan ketentuan dalam UUJN, kecuali ada alasan untuk menolaknya. Asas ini mengutamakan keahlian (keilmuan) Notaris dalam menjalankan tugas jabatannya, berdasarkan UUJN dan Kode Etik jabatan Notaris. Tindakan professional Notaris dalam menjalankan tugas jabatannya diwujudkan dalam melayani masyarakat dan akta yang dibuat di hadapan atau oleh Notaris.

kuliah 09
KULIAH 09

Terhadap mereka yang menyandang jabatan Notaris UUJN mempersyaratkan sebagai berikut :

slide310
Untuk dapat diangkat sebagai Notaris harus memenuhi syarat :

Pasal 3

Syarat untuk dapat diangkat menjadi Notaris sebagaimana dimaksud

dalam Pasal 2 adalah :

  • warga negara Indonesia;
  • bertakwa kepada Tuhan Yang Maha Esa;
  • berumur paling sedikit 27 (duapuluh tujuh) tahun;
  • sehat jasmani dan rohani;
  • berijazah sarjana Hukum dan lulusan jenjang stara dua kenotariatan;
  • telah menjalani magang atau nyata-nyata telah bekerja sebagai karyawan Notaris dalam waktu 12 (duabelas) bulan berturut-berturut pada kantor Notaris atas prakarsa sendiri atau atas rekomondasi Organisasi Notaris setelah lulus srata dua kenotariatan; dan
  • tidak berstatus sebagai pegawai negeri, pejabat negara, advokat, atau tidak sedang memangku jabatan lain yang oleh undang-undang dilarang untuk dirangkap dengan jabatan Notaris.
slide311
Pasal 4
  • Sebelum menjalankan jabatannya, Notaris wajib mengucapkan sumpah/janji menurut agamanya dihadapanMenteri ataupejabat yang ditunjuk.
  • Sumpah/janji sebagaimana dimaksud pada ayat (1) berbunyi sebagai berikut :

“Saya bersumpah/berjanji :

-bahwa saya akan patuh dan setia kepada Negara Republik Indonesia,

Pancasila dan Undang-Undang Dasar Negara Republik Indonesia Tahun

1945, Undang-Undang tentang Jabatan Notaris serta peraturan perundang-

undangan lainnya.

-bahwa saya akan menjalankan jabatan saya dengan amanah, jujur, saksama,

mandiri, dan tidak berpihak.

-bahwa saya akan menjaga sikap, tingkah laku saya, dan akan menjalankan

kewajiban saya sesuai dengan kode etik profesi, kehormatan, martabat, dan

tanggung jawab saya sebagai Notaris.

-bahwa saya akan merahasiakan isi akta dan keterangan yang diperoleh dalam

pelaksanaan jabatan saya.

-bahwa saya untuk dapat diangkat dalam jabatan ini, baik secara langsung

maupun tidak langsung, dengan nama atau dalih apapun, tidak pernah dan

tidak akan memberikan atau menjanjikan sesuatu kepada siapapun.”

slide312
Pasal 16

(1) Dalammenjalankanjabatannya, Notarisberkewajiban :

(a) bertindakjujur, seksama, mandiri, tidakberpihak, danmenjagakepentinganpihak yang terkaitdalamperbuatanhukum;

(e) Merahasiakansegalasesuatumengenaiakta yang dibuatnyadansegalaketerangan yang diperolehgunapembuatanaktasesuaidengansumpah/janjijabatan, kecualiundang-undangmenentukan lain;

slide313
Pasal 17

Notaris dilarang :

  • menjalankan jabatan di luar wilayah jabatannya;
  • meninggalkan wilayah jabatannya lebih dari 7 (tujuh) hari kerja berturut-turut tanpa alasan yang sah;
  • merangkap sebagai pegawai negeri;
  • merangkap jabatan sebagai pejabat negara;
  • merangkap jabatan sebagai advokat;
  • merangkap jabatan sebagai pemimpin atau pegawai badan usaha milik negara, badan usaha milik daerah atau badan usaha swasta;
  • merangkap jabatan sebagai Pejabat Pembuat Akta tanah di luar wilayah jabatan Notaris;
  • menjadi Notaris Pengganti; atau
  • melakukan pekerjaan lain yang bertentangan dengan norma agama, kesusilaan, atau kepatutan yang dapat mempengaruhi kehormatan dan martabat jabatan Notaris.
slide314
Pasal 37

Notaris wajib memberikan jasa hukum dibidang kenotariatan secara Cuma-Cuma kepada orang yang tidak mampu.

Pasal 82

(1) Notaris berhimpun dalam satu wadah Organisasi Notaris.

slide315
Pengawasan terhadap Notaris  tidak hanya pelaksanaan tugas jabatannya, tapi juga perilaku kehidupan Notaris.

Sehingga dalam UUJN ada :

Larangan

Kewajiban dan

Sanksi.

slide316
MATERI DAN JENIS SANKSI DALAM UNDANG-UNDANG JABATAN NOTARIS1. HAKIKAT DAN JENIS SANKSI SANKSI PERDATA.2. BATASAN AKTA NOTARIS YANG MEMPUNYA KEKUATAN PEMBUKTIAN SEBAGAI AKTA D BAWAH TANGAN. 3. BATASAN AKTA NOTARIS BATAL DEMI HUKUM. 4. HUBUNGAN HUKUM NOTARIS DAN PARA PENGHADAP SEBAGAI DASAR UNTUK MENENTUKAN SANKSIPERDATA. 5. SANKSI ADMINISTRATIF. 6. SANKSI LAINNYA DAN KUMULASI SANKSI TERHADAP NOTARIS. 7. BATASAN-BATASAN AKTA NOTARIS YANG DAPAT DIJADIKAN ALASAN UNTUK MEMPIDANAKAN NOTARIS.
1 hakikat dan jenis sanksi
1. HAKIKAT DAN JENIS SANKSI
  • SANKSI MERUPAKAN ALAT PEMAKSA, SELAIN HUKUMAN, JUGA UNTUK MENTAATI KETETAPAN YANG DITENTUKAN DALAM PERATURAN ATAU PERJANJIAN.
  • SANKSI JUGA DIARTIKAN SEBAGAI ALAT PEMAKSA SEBAGAI HUKUMAN JIKA TIDAK TAAT KEPADA PERJANJIAN.
  • SANKSI MERUPAKAN ALAT KEKUASAAN YANG BERSIFAT HUKUM PUBLIK YANG DIGUNAKAN OLEH PENGUASA SEBAGAI REAKSI.
hakikat sanksi
HAKIKAT SANKSI
  • MERUPAKAN INSTRUMENT YURIDIS YANG BIASANYA DIBERIKAN APABILA KEWAJIBAN-KEWAJIBAN ATAU LARANGAN-LARANGAN YANG ADA DALAM KETENTUAN HUKUM TELAH DILANGGAR.
  • DIBALIK PINTU KETENTUAN PERINTAH DAN LARANGAN (GEEN VERBODEN) TERSEDIA SANKSI UNTUK MEMAKSA KEPATUHAN.
  • SEBAGAI SUATU PAKSAAN BERDASARKAN HUKUM, JUGA UNTUK MEMBERIKAN PENYADARAN KEPADA PIHAK YANG MELANGGARNYA, BAHWA SUATU TINDAKAN YANG DILAKUKANNYA TELAH TIDAK SESUAI DENGAN ATURAN HUKUM YANG BERLAKU,
  • UNTUK MENGEMBALIKAN YANG BERSANGKUTAN AGAR BERTINDAK SESUAI DENGAN ATURAN HUKUM YANG BERLAKU, JUGA UNTUK MENJAGA KESEIMBANGAN BERJALANNYA SUATU ATURAN HUKUM.
sanksi yang ditujukan terhadap notaris
SANKSI YANG DITUJUKAN TERHADAP NOTARIS :
  • MERUPAKAN SEBAGAI PENYADARAN, BAHWA NOTARIS DALAM MELAKUKAN TUGAS JABATANNYA TELAH MELANGGAR KETENTUAN-KETENTUAN MENGENAI PELAKSANAAN TUGAS JABATAN NOTARIS SEBAGAIMANA TERCANTUM DALAM UUJN,
  • UNTUK MENGEMBALIKAN TINDAKAN NOTARIS DALAM MELAKSANAKAN TUGAS JABATANNYA UNTUK TERTIB SESUAI DENGAN UUJN,
  • UNTUK MELINDUNGI MASYARAKAT DARI TINDAKAN NOTARIS YANG DAPAT MERUGIKAN MASYARAKAT, MISALNYA MEMBUAT AKTA YANG TIDAK MELINDUNGI HAK-HAK YANG BERSANGKUTAN SEBAGAIMANA YANG TERSEBUT DALAM AKTA NOTARIS.
  • UNTUK MENJAGA MARTABAT LEMBAGA NOTARIS, SEBAGAI LEMBAGA KEPERCAYAAN, KARENA JIKA NOTARIS MELAKUKAN PELANGGARAN, DAPAT MENURUNKAN KEPERCAYAAN MASYARAKAT TERHADAP NOTARIS.
  • SECARA INDIVIDU SANKSI TERHADAP NOTARIS MERUPAKAN SUATU NESTAPA DAN PERTARUHAN DALAM MENJALANKAN TUGAS JABATANNYA, APAKAH MASYARAKAT MASIH MAU MEMPERCAYAKAN PEMBUATAN AKTA TERHADAP NOTARIS YANG BERSANGKUTAN ATAU TIDAK.
  • UUJN YANG MENGATUR JABATAN NOTARIS BERISIKAN KETENTUAN-KETENTUAN YANG BERSIFAT MEMAKSA ATAU MERUPAKAN SUATU ATURAN HUKUM YANG IMPERATIF UNTUK DITEGAKKAN TERHADAP NOTARIS YANG TELAH MELAKUKAN PELANGGARAN DALAM MENJALANKAN TUGAS JABATANNYA.
jenis sanksi
JENIS SANKSI

SANKSI TERHADAP NOTARIS DIATUR PADA AKHIR UUJN, YAITU PADA PASAL 84 DAN 85 UUJN, ADA 2 (DUA) MACAM, YAITU :

1. SANKSI PERDATA (PASAL 84 UUJN).

SANKSI INI BERUPA PENGGANTIAN BIAYA, GANTI RUGI, DAN BUNGA MERUPAKAN AKIBAT YANG AKAN DITERIMA NOTARIS ATAS TUNTUTAN PARA PENGHADAP JIKA AKTA YANG BERSANGKUTAN HANYA MEMPUNYAI KEKUATANPEMBUKTIAN SEBAGAI AKTA DIBAWAH TANGAN ATAU AKTA MENJADI BATAL DEMI HUKUM.

slide321
2.SANKSI ADMINISTRATIF (PASAL 85 UUJN).SANKSI INI BERUPA :- TEGURAN LISAN.- TEGURAN TERTULIS.- PEMBERHENTIAN SEMENTARA;- PEMBERHENTIAN DENGAN HORMAT;- PEMBERHENTIAN TIDAK HORMAT.
2 batasan akta notaris yang mempunya kekuatan pembuktian sebagai akta d bawah tangan
2. BATASAN AKTA NOTARIS YANG MEMPUNYA KEKUATAN PEMBUKTIAN SEBAGAI AKTA D BAWAH TANGAN.

PASAL 1869 B.W. MENENTUKAN BATASAN AKTA NOTARIS YANG MEMPUNYAI KEKUATAN PEMBUKTIAN SEBAGAI AKTA DIBAWAH TANGAN DAPAT TERJADI JIKA TIDAK MEMENUHI KETENTUAN KARENA :

(1) TIDAK BERWENANGNYA PEJABAT UMUM YANG

BERSANGKUTAN, ATAU

(2) TIDAK MAMPUNYA PEJABAT UMUM YANG

BERSANGKUTAN, ATAU

(3) CACAT DALAM BENTUKNYA,

MESKIPUN DEMIKIAN AKTA SEPERTI ITU TETAP MEMPUNYAI KEKUATAN PEMBUKTIAN SEBAGAI AKTA DIBAWAH TANGAN JIKA AKTA TERSEBUT DITANDATANGANI OLEH PARA PIHAK.

3 batasan akta notaris batal demi hukum
3. BATASAN AKTA NOTARIS BATAL DEMI HUKUM.

KETENTUAN-KETENTUAN JIKA DILANGGAR AKTA NOTARIS MEMPUNYAI KEKUATAN PEMBUKTIAN SEBAGAI AKTA DIBAWAH TANGAN DISEBUTKAN DENGAN TEGAS DALAM PASAL-PASAL TERTENTU DALAM UUJN YANG BERSANGKUTAN SEBAGAIMANA TERSEBUT DI ATAS, MAKA DAPAT DITAFSIRKAN BAHWA KETENTUAN-KETENTUAN YANG TIDAK DISEBUTKAN DENGAN TEGAS AKTA NOTARIS MEMPUNYAI KEKUATAN PEMBUKTIAN SEBAGAI AKTA DI BAWAH TANGAN, MAKA SELAIN ITU TERMASUK KEDALAM AKTA NOTARIS YANG BATAL DEMI HUKUM,

4 hubungan hukum notaris dan para penghadap sebagai dasar untuk menentukan sanksiperdata
4. HUBUNGAN HUKUM NOTARIS DAN PARA PENGHADAP SEBAGAI DASAR UNTUK MENENTUKAN SANKSIPERDATA.

KETIKA PENGHADAP DATANG KE NOTARIS AGAR TINDAKAN ATAU PERBUATANNYA DIFORMULASIKAN KE DALAM AKTA OTENTIK SESUAI DENGAN KEWENANGAN NOTARIS, DAN KEMUDIAN NOTARIS MEMBUATKAN AKTA ATAS PERMINTAAN ATAU KEINGINAN PARA PENGHADAP TERSEBUT, MAKA DALAM HAL INI MEMBERIKAN LANDASAN KEPADA NOTARIS DAN PARA PENGHADAP TELAH TERJADI HUBUNGAN HUKUM. OLEH KARENA ITU NOTARIS HARUS MENJAMIN BAHWA AKTA YANG DIBUAT TERSEBUT TELAH SESUAI MENURUT ATURAN HUKUM YANG SUDAH DITENTUKAN, SEHINGGA KEPENTINGAN YANG BERSANGKUTAN TERLINDUNGI DENGAN AKTA TERSEBUT. DENGAN HUBUNGAN HUKUM SEPERTI ITU, MAKA PERLU DITENTUKAN KEDUDUKAN HUBUNGAN HUKUM TERSEBUT YANG MERUPAKAN AWAL DARI TANGGUNGGUGAT NOTARIS.

slide325
HUBUNGAN HUKUM NOTARIS DAN PARA PENGHADAP MERUPAKAN HUBUNGAN HUKUM YANG KHAS, DENGAN KARAKTER :1. TIDAK PERLU DIBUAT SUATU PERJANJIAN BAIK LISAN MAUPUN TERTULIS DALAM BENTUK PEMBERIAN KUASA UNTUK MEMBUAT AKTA ATAU UNTUK MELAKUKAN PEKERJAAN-PEKERJAAN TERTENTU.2. MEREKA YANG DATANG KE HADAPAN NOTARIS, DENGAN ANGGAPAN BAHWA NOTARIS MEMPUNYAI KEMAMPUAN UNTUK MEMBANTU MEMFORMULASIKAN KEINGINAN PARA PIHAK SECARA TERTULIS DALAM BENTUK AKTA OTENTIK.3. HASIL AKHIR DARI TINDAKAN NOTARIS BERDASARKAN KEWENANGAN NOTARIS YANG BERASAL DARI PERMINTAAN ATAU KEINGIAN PARA PIHAK SENDIRI, DAN4. NOTARIS BUKAN PIHAK DALAM AKTA YANG BERSANGKUTAN.
slide326
PADA DASARNYA BAHWA HUBUNGAN HUKUM ANTARA NOTARIS DAN PARA PENGHADAP YANG TELAH MEMBUAT AKTA DI HADAPAN ATAU OLEH NOTARIS TIDAK DAPAT DIKONTRUKSIKAN DITENTUKAN PADA AWAL NOTARIS DAN PARA PENGHADAP BERHUBUNGAN, KARENA PADA SAAT ITU BELUM TERJADI PERMASALAHAN APAPUN. UNTUK MENENTUKAN BENTUK HUBUNGAN ANTARA NOTARIS DENGAN PARA PENGHADAP HARUS DIKAITKAN DENGAN KETENTUAN DENGAN PASAL 1869 BW, BAHWA AKTA OTENTIK TERDEGRADASI MENJADI MEMPUNYAI KEKUATAN PEMBUKTIAN SEBAGAI AKTA DIBAWAH TANGAN DENGAN ALASAN :(1) TIDAK BERWENANGNYA PEJABAT UMUM YANG BERSANGKUTAN, ATAU (2) TIDAK MAMPUNYA PEJABAT UMUM YANG BERSANGKUTAN, ATAU (3) CACAT DALAM BENTUKNYA,
slide327
ATAU KARENA AKTA NOTARIS DIBATALKAN BERDASARKAN PUTUSAN PENGADILAN YANG TELAH MEMPUNYAI KEKUATAN HUKUM, MAKA HAL INI DAPAT DIJADIKAN DASAR UNTUK MENGGUGAT NOTARIS SEBAGAI SUATU PERBUATAN MELAWAN HUKUM ATAU DENGAN KATA LAIN HUBUNGAN NOTARIS DAN PARA PENGHADAP DAPAT DIKUALIFIKASIKAN SEBAGAI PERBUATAN MELAWAN HUKUM, KARENA :
  • NOTARIS TIDAK BERWENANG MEMBUAT AKTA YANG BERSANGKUTAN.
  • TIDAK MAMPUNYA NOTARIS YANG BERSANGKUTAN DALAM MEMBUAT AKTA,
  • AKTA NOTARIS CACAT DALAM BENTUKNYA,
slide328
DENGAN DEMIKIAN KEDUDUKAN AKTA NOTARIS YANG MEMPUNYAI KEKUATAN PEMBUKTIAN SEBAGAI AKTA DIBAWAH TANGAN ATAU AKTA NOTARIS MENJADI BATAL DEMI HUKUM TIDAK BERDASARKAN AKTA NOTARIS TIDAK MEMENUHI SYARAT SUBJEKTIF DAN SYARAT OBJEKTIF TAPI DALAM HAL INI :
slide329
UNDANG-UNDANG (UUJN) TELAH MENENTUKAN SENDIRI KETENTUAN SYARAT AKTA NOTARIS YANG MEMPUNYAI KEKUATAN PEMBUKTIAN SEBAGAI AKTA DIBAWAH TANGAN ATAU AKTA NOTARIS MENJADI BATAL DEMI HUKUM AKTA, YAITU TIDAK MEMENUHI SYARAT EKSTERNAL.
  • NOTARIS TELAH TIDAK CERMAT, TIDAK TELITI DAN TIDAK TEPAT DALAM MENERAPKAN ATURAN HUKUM YANG BERKAITAN PELAKSANAAN TUGAS JABATAN NOTARIS BERDASARKAN UUJN, DAN JUGA DALAM MENERAPKAN ATURAN HUKUM YANG BERKAITAN DENGAN ISI AKTA.
slide330
TUNTUTAN TERHADAP NOTARIS DALAM BENTUK PENGGANTIAN BIAYA, GANTI RUGI DAN BUNGA SEBAGAI AKIBAT AKTA NOTARIS MEMPUNYAI KEKUATAN PEMBUKTIAN SEBAGAI AKTA DI BAWAH TANGAN ATAU BATAL DEMI HUKUM, BERDASARKAN ADANYA :
  • HUBUNGAN HUKUM YANG KHAS ANTARA NOTARIS DENGAN PARA PENGHADAP DENGAN BENTUK SEBAGAI PERBUATAN MELAWAN HUKUM.
  • KETIDAKCERMATAN, KETIDAKTELITIAN DAN KETIDAKTEPATAN DALAM :
    • TEKNIK ADMINISTRATIF MEMBUAT AKTA BERDASARKAN UUJN,
    • PENERAPAN BERBAGAI ATURAN HUKUM YANG TERTUANG DALAM AKTA YANG BERSANGKUTAN UNTUK PARA PENGHADAP, YANG TIDAK DIDASARKAN PADA KEMAMPUAN MENGUASAI KEILMUAN BIDANG NOTARIS SECARA KHUSUS DAN HUKUM PADA UMUMNYA.
slide331
SEBELUM NOTARIS DIJATUHI SANKSI PERDATA BERUPA PENGGANTIAN BIAYA, GANTI RUGI DAN BUNGA, MAKA TERLEBIH DAHULU HARUS DAPAT DIBUKTIKAN BAHWA :

a. ADANYA DIDERITA KERUGIAN;

b. ANTARA KERUGIAN YANG DIDERITA DAN

PELANGGARAN ATAU KELALAIAN DARI

NOTARIS TERDAPAT HUBUNGAN KAUSAL;

c. PELANGGARAN (PERBUATAN) ATAU

KELALAIAN TERSEBUT DISEBABKAN

KESALAHAN YANG DAPAT

DIPERTANGGUNGJAWABKAN KEPADA NOTARIS

YANG BERSANGKUTAN.

5 sanksi administratif
5. SANKSI ADMINISTRATIF.

DALAM PASAL 85 UUJN DITENTUKAN ADA 5 (LIMA) JENIS SANKSI ADMINISTRATIF, YAITU :

  • TEGURAN LISAN.
  • TEGURAN TERTULIS.
  • PEMBERHENTIAN SEMENTARA.
  • PEMBERHENTIAN DENGAN HORMAT.
  • PEMBERHENTIAN TIDAK HORMAT.
slide333
SANKSI-SANKSI TERSEBUT BERLAKUNYA SECARA BERJENJANG MULAI DARI TEGURAN LISAN SAMPAI DENGAN PEMBERHENTIAN TIDAK HORMAT, KARENA NOTARIS MELANGGAR PASAL-PASAL TERTENTU YANG TERSEBUT DALAM PASAL 85 UUJN
6 sanksi lainnya dan kumulasi sanksi terhadap notaris
6. SANKSI LAINNYA DAN KUMULASI SANKSI TERHADAP NOTARIS.

SANKSI TERHADAPNOTARIS MENUNJUKKAN NOTARIS BUKAN SEBAGAI SUBJEK YANG KEBAL TERHADAP HUKUM. TERHADAP NOTARIS DAPAT DIJATUHI SANKSI PERDATA DAN ADMINISTRATIF SEPERTI TERSEBUT DI ATAS, JUGA DAPAT DIJATUHI SANKSI ETIKA DAN SANKSI PIDANA.

slide335
SANKSI PERDATA DAN ADMINISTRATIF  UUJN-SANKSI ETIKA DAPAT DIJATUHKAN TERHADAP NOTARIS, KARENA NOTARIS MELAKUKAN PELANGGARAN TERHADAP KODE ETIK JABATAN NOTARIS. SANKSI TERSEBUT DIJATUHKAN OLEH MAJELIS KEHORMATAN NOTARIS, BAHWA SANKSI TERTINGGI DARI MAJELIS KERHORMATAN NOTARIS INI BERUPA PEMBERHENTIAN SECARA TIDAK HORMAT ATAU SECARA HORMAT DARI KEANGGOTAAN ORGANISASI JABATAN NOTARIS.
slide336
SANKSI PIDANA TERHADAP NOTARIS HARUS DILIHAT DALAM RANGKA MENJALANKAN TUGAS JABATAN NOTARIS, ARTINYA DALAM PEMBUATAN ATAU PROSEDUR PEMBUATAN AKTA HARUS BERDASARKAN KEPADA ATURAN HUKUM YANG MENGATUR HAL TERSEBUT, DALAM HAL INI UUJN. JIKA SEMUA TATA CARA PEMBUATAN AKTA SUDAH DITEMPUH SUATU HAL YANG TIDAK MUNGKIN SECARA SENGAJA NOTARIS MELAKUKAN SUATU TINDAK PIDANA YANG BERKAITAN DENGAN AKTA TERSEBUT. SUATU TINDAKAN BUNUH DIRI, JIKA SEORANG NOTARIS SECARA SENGAJA BERSAMA-SAMA ATAU MEMBANTU PENGHADAP SECARA SADAR MEMBUAT AKTA UNTUK MELAKUKAN SUATU TINDAK PIDANA. PENGERTIAN SENGAJA (DOLUS) YANG DILAKUKAN OLEH NOTARIS, MERUPAKAN SUATU TINDAKAN YANG DISADARI, ATAU DIRENCANAKAN DAN DIINSYAFI SEGALA AKIBAT HUKUMNYA, DALAM HAL NOTARIS SEBAGAI SUMBER UNTUK MELAKUKAN KESENGAJAAN BERSAMA-SAMA DENGAN PARA PENGHADAP. SANKSI PIDANA TERHADAP NOTARIS TUNDUK TERHADAP KETENTUAN PIDANA UMUM, YAITU KUHP. UUJN TIDAK MENGATUR MENGENAI TINDAK PIDANA KHUSUS UNTUK NOTARIS.
7 batasan batasan akta notaris yang dapat dijadikan alasan untuk mempidanakan notaris
7. BATASAN-BATASAN AKTA NOTARIS YANG DAPAT DIJADIKAN ALASAN UNTUK MEMPIDANAKAN NOTARIS.

PEMIDANAAN TERHADAP NOTARIS DAPAT SAJA DILAKUKAN DENGAN BATASAN, JIKA :

  • ADA TINDAKAN HUKUM DARI NOTARIS TERHADAP ASPEK FORMAL AKTA YANG SENGAJA, PENUH KESADARAN DAN KEINSYAFAN SERTA DIRENCANAKAN, BAHWA AKTA YANG DIBUAT DI HADAPAN NOTARIS ATAU OLEH NOTARIS BERSAMA-SAMA (SEPAKAT) UNTUK DIJADIKAN DASAR UNTUK MELAKUKAN SUATU TINDAK PIDANA.
  • ADA TINDAKAN HUKUM DARI NOTARIS DALAM MEMBUAT AKTA DI HADAPAN ATAU OLEH NOTARIS YANG JIKA DIUKUR BERDASARKAN UUJN TIDAK SESUAI DENGAN UUJN, DAN
  • TINDAKAN NOTARIS TERSEBUT JUGA TIDAK SESUAI MENURUT INSTANSI YANG BERWENANG UNTUK MENILAI TINDAKAN SUATU NOTARIS, DALAM HAL INI MAJELIS PENGAWAS NOTARIS.
slide338
PEMERIKSAAN ATAS PELANGGARAN YANG DILAKUKAN OLEH NOTARIS HARUS DILAKUKAN PEMERIKSAAN YANG HOLISTIK-INTEGRAL, DENGAN MELIHAT ASPEK LAHIRIAH, FORMAL DAN MATERIL AKTA NOTARIS, DAN PELAKSANAAN TUGAS JABATAN NOTARIS SESUAI WEWENANG NOTARIS, DISAMPING BERPIJAK PADA ATURAN HUKUM YANG MENGATUR TINDAKAN PELANGGARAN YANG DILAKUKAN NOTARIS, JUGA PERLU DIPADUKAN DENGAN DENGAN REALITAS PRAKTEK NOTARIS.
slide339
NOTARIS BUKAN TUKANG MEMBUAT AKTA ATAU ORANG YANG MEMPUNYAI PERKEJAAN MEMBUAT AKTA, TAPI NOTARIS DALAM MENJALANKAN TUGAS JABATANNYA DIDASARI ATAU DILENGKAPI BERBAGAI ILMU PENGETAHUAN HUKUM DAN ILMU-ILMU LAINNYA YANG HARUS DIKUASAI SECARA TERINTEGRASI OLEH NOTARIS DAN AKTA YANG DIBUAT DI HADAPAN ATAU OLEH NOTARIS MEMPUNYAI KEDUDUKAN SEBAGAI ALAT BUKTI, DENGAN DEMIKIAN NOTARIS HARUS MEMPUNYAI CAPITAL INTELLECTUAL YANG BAIK DALAM MENJALANKAN TUGAS JABATANNYA. PEMERIKSAAN TERHADAP NOTARIS KURANG MEMADAI JIKA DILAKUKAN OLEH MEREKA YANG BELUM MENDALAMI DUNIA NOTARIS, ARTINYA MEREKA YANG AKAN MEMERIKSA NOTARIS HARUS DAPAT MEMBUKTIKAN KESALAHAN BESAR YANG DILAKUKAN NOTARIS SECARA INTELEKTUAL, DALAM HAL INI KEKUATAN LOGIKA (HUKUM) YANG DIPERLUKAN DALAM MEMERIKSA NOTARIS, BUKAN LOGIKA KEKUATAN (BERARTI KEKUASAAN) YANG DIPERLUKAN DALAM MEMERIKSA NOTARIS.
kuliah 10

KULIAH 10

A. Pengaturan Pengawasan Terhadap Notaris.

slide341
Sebelum berlaku UUJN, pengawasan, pemeriksaan dan penjatuhan sanksi terhadap Notaris dilakukan oleh badan peradilan yang ada pada waktu itu, sebagaimana pernah diatur dalam Pasal 140 Reglement op de Rechtelijke Organisatie en Het Der Justitie (Stbl. 1847 No. 23), Pasal 96 Reglement Buitengewesten, Pasal 3 Ordonantie Buitengerechtelijke Verrichtingen – Lembaran Negara 1946 Nomor 135, dan Pasal 50 PJN, kemudian Pengawasan terhadap Notaris dilakukan Peradilan Umum dan Mahkamah Agung sebagaimana tersebut dalam Pasal 32 dan 54 Undang-undang Nomor 13 Tahun 1965 tentang Pengadilan Dalam Lingkungan Peradilan Umum dan Mahkamah Agung.

341

slide342
Kemudian dibuat pula Surat Edaran Mahkamah Agung Republik Indonesia Nomor 2 Tahun 1984 tentang Tata Cara Pengawasan Terhadap Notaris, Keputusan Bersama Ketua Mahkamah Agung dan Menteri Kehakiman Nomor KMA/006/SKB/VII/1987 tentang Tata Cara Pengawasan, Penindakan dan Pembelaan Diri Notaris, dan terakhir dalam Pasal 54 Undang-undang Nomor 8 Tahun 2004.

342

slide343
Dalam kaitan tersebut di atas, meskipun Notaris diangkat oleh pemerintah (dahulu oleh Menteri Kehakiman, sekarang oleh Menteri Hukum dan HAM) mengenai pengawasannya dilakukan olen badan peradilan, hal ini dapat dipahami karena pada waktu itu kekuasaan kehakiman ada pada Departemen Kehakiman/Kementerian Hukum dan HAM.
slide344
Tahun 1999 sampai dengan tahun 2001 dilakukan dilakukan perubahan terhadap Undang-undang Dasar (UUD) 1945, dan dengan amandemen tersebut telah pula merubah Kekuasaan Kehakiman. Dalam Pasal 24 ayat (2) UUD 1945 menegaskan bahwa Kekuasaan Kehakiman dilakukan oleh sebuah Mahkamah Agung dan badan peradilan yang berada dibawahnya dalam lingkungan peradilan umum, lingkungan peradilan agama, lingkungan peradilan militer, lingkungan peradilan tata usaha negara dan oleh sebuah Mahkamah Konstitusi.
slide345
Sebagai tindak lanjut dari perubahan tersebut dibuat Undang-undang Nomor 4 Tahun 2004 tentang Kekuasaan Kehakiman, dalam Pasal 2 ditegaskan bahwa penyelenggaraan kekuasaan kehakiman oleh sebuah Mahkamah Agung dan badan peradilan yang berada dibawahnya dalam lingkungan peradilan umum, lingkungan peradilan agama, lingkungan peradilan militer, lingkungan peradilan tata usaha negara dan oleh sebuah Mahkamah Konstitusi. Dalam Pasal 1 Undang-undang Nomor 5 Tahun 2004 tentang Perubahan Atas Undang-undang Nomor 14 Tahun 1985 Tentang Mahkamah Agung, ditegaskan bahwa Mahkamah Agung sebagai pelaku salah satu kekuasaan kehakiman sebagaimana dimaksud dalam UUD 1945.
slide346
346

Mahkamah Agung berdasarkan aturan hukum tersebut hanya mempunyai kewenangan dalam bidang peradilan saja, sedangkan dari segi organisasi, administrasi dan finansial menjadi kewenangan Departemen Kehakiman. Pada tahun 2004 dibuat Undang-undang Nomor 8 Tahun 2004, dalam Pasal 5 ayat (1) ditegaskan bahwa pembinaan teknis peradilan, organisasi, administrasi, dan finansial pengadilan dilakukan oleh Mahkamah Agung.

slide347
Sejak pengalihan kewenangan tersebut, Notaris yang diangkat oleh pemerintah (Menteri) tidak tepat lagi jika pengawasannya dilakukan oleh instansi lain dalam hal ini badan peradilan, karena Menteri sudah tidak mempunyai kewenangan apapun terhadap badan peradilan, kemudian tentang pengawasan terhadap Notaris yang diatur dalam Pasal 54 Undang-undang Nomor 8 Tahun 2004 dicabut oleh Pasal 91 UUJN.
slide348
Setelah berlakunya UUJN badan peradilan tidak lagi melakukan pengawasan, pemeriksaan dan penjatuhan terhadap Notaris, tapi pengawasan, pemeriksan dan penjatuhan sanksi terhadap Notaris dilakukan oleh Menteri Hukum dan HAM dengan membentuk :

Majelis Pengawas Notaris.

slide349
349

B. Majelis Pengawas Notaris Sebagai Instansi yang Melakukan Pengawasan, Pemeriksaan dan Menjatuhkan Sanksi Terhadap Notaris.

slide350
TUJUAN PENGAWASAN :

Agar para Notaris ketika menjalankan tugas jabatannya memenuhi semua persyaratan yang berkaitan dengan pelaksanaan tugas jabatan Notaris, demi untuk pengamanan dari kepentingan masyarakat, karena Notaris diangkat oleh pemerintah, bukan untuk kepentingan diri Notaris sendiri, tapi untuk kepentingan masyarakat yang dilayaninya

slide351
Tujuan lain dari pengawasan terhadap Notaris, bahwa Notaris dihadirkan untuk melayani kepentingan masyarakat yang membutuhkan alat bukti berupa akta otentik sesuai permintaan yang bersangkutan kepada Notaris, sehingga tanpa adanya masyarakat yang membutuhkan Notaris, maka Notaris tidak ada gunanya.
slide352
Meskipun demikian tidak berarti dengan bergantinya instansi yang melakukan pengawasan Notaris tidak akan terjadi pelanggaran-pelanggaran yang dilakukan Notaris, karena betapapun ketatnya pengawasan yang dilakukan Majelis Pengawas Notaris, tidak mudah untuk melakukan pengawasan tersebut, hal ini terpulang kepada Notaris sendiri dengan kesadaran dan penuh tanggungjawab dalam tugas jabatannya mengikuti atau berdasarkan aturan hukum yang berlaku, dan tidak kalah pentingnya, yaitu peranan masyarakat untuk mengawasi dan senantiasa melaporkan tindakan Notaris yang dalam melaksanakan tugas jabatannya tidak sesuai dengan aturan hukum yang berlaku kepada Majelis Pengawas Notaris setempat, dengan adanya laporan seperti ini dapat mengeliminasi tindakan Notaris yang tidak sesuai dengan aturan hukum pelaksanaan tugas jabatan Notaris
slide353
Pasal 67 ayat (1) UUJN menentukan bahwa yang melakukan pengawasan terhadap Notaris dilakukan oleh Menteri. Dalam melaksanakan pengawasan tersebut Menteri membentuk Majelis Pengawas (Pasal 67 ayat (2) UUJN). Pasal 67 ayat (3) UUJN menentukan Majelis Pengawas tersebut terdiri dari 9 (sembilan) orang, terdiri dari unsur :

a. pemerintah sebanyak 3 (tiga) orang;

b. organisasi Notaris sebanyak 3 (tiga)

orang; dan

c. ahli/akademik sebanyak 3 (tiga) orang

353

slide354
Menurut Pasal 68 UUJN, bahwa Majelis Pengawas Notaris, terdiri atas :

a. Majelis Pengawas Daerah;

b. Majelis Pengawas

Wilayah; dan

c. Majelis Pengawas Pusat.

slide355
MajelisPengawas Daerah (MPD) dibentukdanberkedudukandikabupatenataukota (Pasal 69 ayat (1) UUJN), MajelisPengawas Wilayah (MPW) dibentukdanberkedudukandiibukotapropinsi (Pasal 72 ayat (1) UUJN), danMajelisPengawasPusat (MPP) dibentukdanberkedudukandiibukotanegara (Pasal 76 ayat (1) UUJN).
slide356
Pengawasan dan pemeriksaan terhadap Notaris yang dilakukan oleh Majelis Pengawas, yang didalamnya ada unsur Notaris, dengan demikian setidaknya Notaris diawasi dan diperiksa oleh anggota Majelis Pengawas yang memahami dunia Notaris. Adanya anggota Majelis Pengawas dari Notaris merupakan pengawasan internal artinya dilakukan oleh sesama Notaris yang memahami dunia Notaris luar-dalam, sedangkan unsur lainnya merupakan unsur eksternal yang mewakili dunia akademik, pemerintah dan masyarakat. Perpaduan keanggotan Majelis Pengawas diharapkan dapat memberikan sinergi pengawasan dan pemeriksaan yang objektif, sehingga setiap pengawasan dilakukan berdasarkan aturan hukum yang berlaku, dan para Notaris dalam menjalankan tugas jabatannya tidak menyimpang dari UUJN karena diawasi secara internal dan eksternal.
slide357
Majelis Pengawas Notaris, tidak hanya melakukan pengawasan dan pemeriksaan terhadap Notaris, tapi juga berwenang untuk menjatuhkan sanksi tertentu terhadap Notaris yang telah terbukti melakukan pelanggaran dalam menjalankan tugas jabatan Notaris.

357

slide359
Majelis Pengawas Notaris sebagai satu-satunya instansi yang berwenang melakukan pengawasan, pemeriksaan dan menjatuhkan sanksi terhadap Notaris, tiap jenjang Majelis Pengawas (MPD, MPW dan MPP) mempunyai wewenang

masing-masing.

slide360
Wewenang tersebut secara substansi diatur dalam UUJN, juga diatur dalam Peraturan Menteri Hukum dan Hak Asasi Manusia Republik Indonesia Nomor M.02.PR.08.10 Tahun 2004, dan Keputusan Menteri Hukum dan Hak Asasi Manusia Republik Indonesia Nomor M. 39-PW.07.10. Tahun 2004.
slide361
MajelisPengawas Daerah (MPD)mempunyaiwewenangkhusus yang diaturdalamPasal 66 UUJN sudahtidakadalagi (Lihat : PUTUSAN

MAHKAMAH KONSTITUSI (MK)

NOMOR 49/PUU-X/2012)

slide362
UUJN tidak saja mengatur mengenai Notaris, tapi juga mengatur mengenai Pejabat Sementara Notaris, Notaris Pengganti dan Notaris Pengganti Khusus. Istilah-istilah tersebut berkaitan dengan Jabatan Notaris dan pertanggungjawabannya.
slide363
DengandemikianpertanggungjawabanNotaris, NotarisPengganti, NotarisPenggantiKhusus, danPejabatSementaraNotarissebagaijabatan yang bertindakberdasarkankewenangan yang diberikanmenurutUndang-undanagJabatanNotarisdanperaturanperundang-undanganlainnya, seharusnyabertanggungjawabsepanjangmasihmempunyaiwewenanguntukmenjalankantugasjabatansebagaiNotaris. Karenajabatantersebuttidakmelekatterus-menerusselamaNotaris, NotarisPengganti, NotarisPenggantiKhusus, danPejabatSementaraNotarishidup, jabatantersebutmelekatpadajabatantersebutselamabelumpensiundanmasihmempunyaikewenanganberdasarkan UUJN danperaturanperundanganlainnya.
slide364
364

F. MAJELIS PENGAWAS NOTARIS SEBAGAI PEJABAT TATA USAHA NEGARA.

slide365
Pada dasarnya yang mempunyai wewenang melakukan pengawasan dan pemeriksaan terhadap Notaris adalah Menteri Hukum dan Hak Asasi Manusia yang dalam pelaksanaannya Menteri membentuk Majelis Pengawas Notaris. Menteri sebagai kepala Kementerian Hukum dan Hak Asasi Manusia mempunyai tugas membantu Presiden dalam menyelenggarakan sebagian urusan pemerintah di bidang hukum dan hak asasi manusia.

Dengan demikian kewenangan pengawasan terhadap Notaris ada pada pemerintah, sehingga berkaitan dengan cara pemerintah memperoleh wewenang pengawasan tersebut

slide366
Berdasarkan pengertian tersebut di atas, bahwa wewenang untuk melakukan pengawasan terhadap Notaris secara atributif ada pada Menteri sendiri, yang dibuat, diciptakan dan diperintahkan dalam undang-undang sebagaimana tersebut dalam Pasal 67 ayat (1) UUJN.
slide367
Kedudukan Menteri selaku Badan atau Jabatan TUN yang melaksanakan urusan pemerintahan berdasarkan peraturan perundang-undangan yang berlaku membawa konsekuensi terhadap Majelis Pengawas, yaitu Majelis Pengawas berkedudukan pula sebagai Badan atau Jabatan TUN, karena menerima delegasi dari badan atau Jabatan yang berkedudukan sebagai Badan atau Jabatan TUN.

367

slide368
Dengan demikian secara kolegial Majelis Pengawas sebagai :

badan atau Pejabat TUN;

melaksanakan urusan pemerintahan; berdasarkan perundang-undangan yang berlaku, yaitu melakukan pengawasan terhadap Notaris sesuai dengan UUJN.

slide369
Dalam melakukan pengawasan, pemeriksaan dan penjatuhan sanksi Majelis Pengawas harus berdasarkan kewenangan yang telah ditentukan UUJN sebagai acuan untuk mengambil keputusan, hal ini perlu dipahami karena anggota Majelis Pengawas tidak semua berasal dari Notaris, sehingga tindakan atau keputusan dari Majelis Pengawas harus mencerminkan tindakan suatu Majelis Pengawas sebagai suatu badan, bukan tindakan anggota Majelis Pengawas yang dianggap sebagai tindakan Majelis Pengawas.
slide370
Kedudukan Menteri sebagai eksekutif (pemerintah) yang menjalankan kekuasaan pemerintah dalam kualifikasi sebagai Badan atau Jabatan Tata Usaha Negara. Berdasarkan Pasal 67 ayat (2) UUJN Menteri mendelegasikan wewenang pengawasan tersebut kepada suatu badan dengan nama Majelis Pengawas. Majelis Pengawas menurut Pasal 1 ayat (1) Peraturan Menteri Hukum dan Hak Asasi Manusia Republik Indonesia Nomor M.02.PR.08.10 Tahun 2004, adalah suatu badan yang mempunyai kewenangan dan kewajiban untuk melaksanakan pengawasan dan pembinaan terhadap Notaris. Dengan demikian Menteri selaku delegans dan Majelis Pengawas selaku delegataris. Majelis Pengawas sebagai delegataris mempunyai wewenang untuk mengawasi Notaris sepenuhnya, tanpa perlu untuk mengembalikan wewenangnya kepada delegans.
slide371
KESIMPULAN :

MAJELIS PENGAWAS NOTARIS (MPD – MPW – MPP) berkedudukan sebagai PEJABAT atau BADAN TATA USAHA NEGARA.

slide372
G. KEPUTUSAN MAJELIS PENGAWAS SEBAGAI KEPUTUSAN TATA USAHA NEGARA DAN OBJEK SENGKETA TATA USAHA NEGARA.

372

slide373
Bersifat konkret, individual dan final :

Bersifat konkret, artinya objek yang diputuskan dalam Keputusan Tata Usaha Negara itu tidak abstrak, tetapi berwujud, tertentu atau dapat ditentukan, umpamanya keputusan mengenai rumah si A, izin usaha bagi si B, pemberhentian si A sebagai pegawai negeri.

Bersifat individual artinya Keputusan Tata Usaha Negara itu tidak ditujukan untuk umum, tetapi tertentu baik alamat maupun hal yang dituju. Kalau yang dituju itu lebih dari seorang, tiap-tiap nama orang yang terkena keputusan itu disebutkan. Umpamanya keputusan tentang pembuatan atau pelebaran jalan dengan lampiran yang menyebutkan nama-nama orang yang terkena keputusan tersebut.

slide374
Majelis Pengawas dalam kedudukan sebagai Badan atau Jabatan TUN mempunyai kewenangan untuk membuat atau mengeluarkan Surat Keputusan atau Ketetapan yang berkaitan dengan hasil pengawasan, pemeriksaan atau penjatuhan sanksi yang ditujukan kepada Notaris yang bersangkutan. Dengan memenuhi ketentuan Pasal 1 angka 3 Undang-undang Nomor 5 Tahun 1986 tentang Peradilan Tata Usaha Negara.
slide375
Dalam kedudukan seperti itu Surat Keputusan atau Ketetapan Majelis Pengawas dapat dijadikan objek gugatan oleh Notaris ke Pengadilan Tata Usaha Negara (PTUN) sebagai sengketa tata usaha negara. Dalam Pasal 1 ayat (4) Undang-undang Nomor 5 Tahun 1986.
slide376
Jika Notaris merasa bahwa keputusan dari Majelis Pengawas tidak tepat atau memberatkan Notaris yang bersangkutan atau tidak dilakukan yang transparan dan berimbang dalam pemeriksan. Peluang untuk mengajukan ke PTUN tetap terbuka setelah semua upaya administrasi, yang disediakan baik keberatan administratif maupun banding administrasi telah ditempuh, meskipun dalam aturan hukum yang bersangkutan telah menentukan bahwa putusan dari badan atau Jabatan TUN tersebut telah menyatakan final atau tidak dapat ditempuh upaya hukum lain karena pada dasarnya bahwa penggunaan upaya administratif dalam sengketa tata usaha negara bermula dari sikap tidak puas terhadap perbuatan tata usaha negara
slide377
KESIMPULAN :

KEPUTUSAN MAJELIS PENGAWAS NOTARIS (MPD – MPW – MPP) yang konkret, final, individual, dan telah menempuh upaya hukum (prosedur keberatan atau banding administratif), jika Notaris berkeberatan dengan putusan tersebut, maka dapat mengajukan gugatan ke pengadilan tata usaha negara. Dan Keputusan tersebut sebagai Objek Sengketa Tata Usaha Negara.

kuliah 11
KULIAH 11

MEMAHAMI :

HAK DAN KEWAJIBAN INGKAR NOTARIS

slide379
Ketika Mahkamah Konstitusi Republik Indonesia (MKRI) dengan Putusan Nomor : 49/PUU – X/2012 memutuskan telah meniadakan atau mengakhiri kewenangan Majelis Pengawas Daerah (MPD) yang tercantum dalam Pasal 66 ayat (1) UUJN membuat Notaris “terkejut sesaat”, seakan-akan tidak ada perlindungan hukum bagi Notaris dalam menjalankan tugas jabatannya.
slide380
Untuk Notaris tidak perlu kaget – risau – galau atas Putusan MKRI tersebut, karena masih ada instrument lain berdasarkan UUJN dan Undang-undang yang lain yang memberikan perlindungan kepada Notaris dalam menjalankan tugas jabatannya.
amar putusan putusan mahkamah konstitusi nomor 49 puu x 2012

AMAR PUTUSAN PUTUSAN MAHKAMAH KONSTITUSI) NOMOR 49/PUU-X/2012

1. Mengabulkan permohonan Pemohon untuk seluruhnya:

1.1 Menyatakan frasa “dengan persetujuan Majelis Pengawas Daerah” dalam Pasal 66 ayat (1) Undang-Undang Nomor 30 Tahun 2004 tentang Jabatan Notaris (Lembaran Negara Republik Indonesia Tahun 2004 Nomor 117, Tambahan Lembaran Negara Republik Indonesia Nomor 4432) bertentangan dengan Undang Undang Dasar Negara Republik Indonesia Tahun 1945;

slide382
1.2 Menyatakan frasa “dengan persetujuan Majelis Pengawas Daerah” dalam Pasal 66 ayat (1) Undang-Undang Nomor 30 Tahun 2004 tentang Jabatan Notaris (Lembaran Negara Republik Indonesia Tahun 2004 Nomor 117, Tambahan Lembaran Negara Republik Indonesia Nomor 4432) tidak mempunyai kekuatan hukum mengikat;

2. Memerintahkan pemuatan putusan ini dalam Berita Negara Republik Indonesia sebagaimana mestinya;

dengan demikian pasal 66 uujn harus dibaca
DENGAN DEMIKIAN PASAL 66 UUJN HARUS DIBACA :

(1)Untukkepentinganprosesperadilan, penyidik, penuntutumum, atau hakim berwenang;

(a) mengambil fotokopi Minuta Akta dan/atau surat-surat yang dilekatkan pada Minuta Akta atau Protokol Notaris dalam penyimpanan Notaris; dan

(b)memanggilNotarisuntukhadirdalampemeriksaan yang berkaitandenganakta yang dibuatnyaatauProtokolNotaris yang beradadalampenyimpananNotaris.

(2). PengambilanfotokopiMinutaAktaatausurat-suratsebagaimanadimaksudpadaayat (1) huruf a, dibuatberitaacarapenyerahan.

slide384
DENGAN KATA LAIN BERDASARKAN PUTUSAN MK TERSEBUT, untuk kepentinganprosesperadilan, penyidik, penuntutumum, atau hakim, berwenang :
  • mengambil fotokopi Minuta Akta dan/atau surat-surat yang dilekatkan pada Minuta Akta atau Protokol Notaris dalam penyimpanan Notaris; dan
  • memanggilNotarisuntukhadirdalampemeriksaan yang berkaitandenganakta yang dibuatnyaatauProtokolNotaris yang beradadalampenyimpananNotaris.

TanpaPersetujuan

MajelisPengawas Daerah

slide385
atau MPD sudahtidakmempunyaikewenanganapapun yang berkaitandenganPasal 66 ayat (1) UUJN. SehinggajikaPenyidik, PenuntutUmumdan Hakim akanmelaksanakanketentuan yang tersebutdalamPasal 66 UUJN terhadapNotaris, makaNotarisharusberhadapanlangsungdenganPenyidik, PenuntutUmumdan Hakim.
slide386
Atas Putusan MKRI para Notaris tidak perlu mempermasalahkannya, sebagai Warga Negara Indonesia yang taat hukum kita tunduk dan patuh pada Putusan MKRI tersebut, karena Putusan MKRI telah

“final and binding”

slide387
PUTUSAN MK MENGENAI PASAL 66 AYAT (1) UUJN TELAH

“FINAL AND BINDING”

PASAL 10 AYAT (1) UNDANG-UNDANG REPUBLIK INDONESIA NOMOR 24 TAHUN 2003 TENTANG MAHKAMAH KONSTITUSI :

(1) Mahkamah Konstitusi berwenang mengadili pada tingkat pertama dan terakhir yang putusannya bersifat final untuk:

a. menguji undang-undang terhadap Undang-Undang Dasar Negara Republik Indonesia Tahun 1945;

b. memutus sengketa kewenangan lembaga negara yang kewenangannya diberikan oleh Undang-Undang DasarNegara Republik Indonesia Tahun 1945;

c. memutus pembubaran partai politik; dan

d. memutus perselisihan tentang hasil pemilihan umum.

slide388
Penjelasan Pasal 10 diubah sehingga berbunyi sebagai berikut:

Pasal 10 Ayat (1) :

Putusan Mahkamah Konstitusi bersifat final, yakni putusan Mahkamah Konstitusi langsung memperoleh kekuatan hukum tetap sejak diucapkan dan tidak ada upaya hukum yang dapat ditempuh. Sifat final dalam putusan Mahkamah Konstitusi dalam Undang-Undang ini mencakup pula kekuatan hukum mengikat

(final and binding).

(UNDANG-UNDANG REPUBLIK INDONESIA NOMOR 8 TAHUN 2011 TENTANG PERUBAHAN ATAS UNDANG-UNDANG NOMOR 24 TAHUN 2003 TENTANG MAHKAMAH KONSTITUSI)

slide389
Pasal 47 UNDANG-UNDANG REPUBLIK INDONESIA NOMOR 24 TAHUN 2003 TENTANG MAHKAMAH KONSTITUSI

“Putusan Mahkamah Konstitusi memperoleh kekuatan hukum tetap sejak selesai diucapkan dalam sidang pleno terbuka untuk umum”.

slide390
Ketentuan Pasal 60 diubah sehingga berbunyi sebagai berikut:

(1) Terhadap materi muatan ayat, pasal, dan/atau bagian dalam undang-undang yang telah diuji, tidak dapat dimohonkan pengujian kembali.

(2) Ketentuan sebagaimana dimaksud pada ayat (1) dapat dikecualikan jika materi muatan dalam Undang-Undang Dasar Negara Republik Indonesia Tahun 1945 yang dijadikan dasar pengujian berbeda.

(UNDANG-UNDANG REPUBLIK INDONESIA NOMOR 8 TAHUN 2011 TENTANG PERUBAHAN ATAS UNDANG-UNDANG NOMOR 24 TAHUN 2003 TENTANG MAHKAMAH KONSTITUSI)

slide391
ADAKAH INSTRUMENT LAIN BAGI NOTARIS SEBAGAI BENTUK PERLINDUNGAN HUKUM DALAM MENJALANKAN TUGAS JABATANNYA BERDASARKAN UNDANG-UNDANG (UUJN ATAU YANG LAINNYA)…?
slide392
PaskaPutusan MKRI tersebut, tidakperlukitaributkanataukitasesali, karenapadadasarnyaNotarismempunyai instrument lain bagiNotarissebagaibentukperlindunganhukumdalammenjalankantugasjabatannyaberdasarkan UUJN danUndang-undang yang lain, yaitupadajabatanNotaristelahadamelekat :

HakIngkar (Verschoningsrecht)

dan

KewajibanIngkar (Verschoningsplicht).

slide393
HakdanKewajibanIngkarNotaris (setelahberlakunya UUJN) tidakpernahdipergunakanNotaris, karenaparaNotarisberlindungdalamkewenangan MPD (Pasal 66 ayat (1) UUJN). BahkahsebenarnyaHakdanKewajibanIngkartelahadasejaklembagakenotariatanlahir.
slide394
SETELAH FRASA “denganpersetujuanMajelisPengawas Daerah” tersebutbertentangandenganUndangUndangDasar Negara Republik Indonesia Tahun 1945; dan “tidakmempunyaikekuatanhukummengikat “

berdasarkanPutusanMahkamahKonstitusi.

MAKA NOTARIS WAJIB UNTUK MEMPERGUNAKAN HAK DAN KEWAJIBAN INGKAR

slide395
Jelas sudah bahwa Notaris mempunyai kewajiban/hak seperti tersebut di atas, pertanyaannya, kenapa para Notaris tidak menyadari punya kewajiban/hak seperti itu ? Bahwa Notaris mempunyai Kewajiban/hak Ingkar bukan untuk kepentingan diri Notaris, tapi untuk kepentingan para pihak yang telah mempercayakan kepada Notaris, bahwa Notaris dipercaya oleh para pihak mampu menyimpan semua keterangan atau pernyataan para pihak yang pernah diberikan di hadapan Notaris yang berkaitan dalam pembuatan akta.
slide396
APAKAH

HAK INGKAR (verschoningsrecht)

DANKEWAJIBAN INGKAR (verschoningsplicht) ?

hak ingkar v erschonings recht
HAK INGKAR (Verschoningsrecht)

Hak Ingkar atau hak menolak sebagai imunitas hukum notaris untuk tidak berbicara atau memberikan keterangan apapun yang berkaitan dengan akta (atau keterangan lainnya yang berkaitan dengan akta) yang dibuat dihadapan atau oleh Notaris sebagai saksi dalam penuntutan dan pengadilan merupakan Verschoningsrecht atau suatu hak untuk tidak berbicara/tidak memberikan informasi apapun didasarkan pada Pasal 170 KUHAP dan

Pasal 1909 ayat (3) KUHPerdata.

slide398
PASAL 170 KUHAP :
  • Mereka yang karena pekerjaan, harkat martabat atau jabatannya diwajibkan menyimpan rahasia, dapat diminta dibebaskan dari kewajibannya untuk memberikan keterangan sebagai saksi yaitu tentang hal yang dipercaya kepada mereka.
  • Hakim menentukan sah atau tidaknya segala alasan untuk permintaan tersebut.
penjelasan
Penjelasan :

Ayat (1)

Pekerjaanataujabatan yang menentukanadanyakewajibanuntukmenyimpanrahasiaditentukanolehperaturanperundang-undangan.

Ayat (2)

Jikatidakadaketentuanperaturanperundang-undangan yang mengaturtentangjabatanataspekerjaandimaksud, makaseperti yang telahditentukanolehayatini, hakim menentukansahatautidaknyaalasan yang dikemukakanuntukmendapatkankebebasantersebut.

slide400
Pasal 1909 KUHPerdata :

Semua orang yang cakap untuk menjadi saksi, diharuskan memberikan kesaksian di muka hakim. Namun dapatlah meminta dibebaskan dari kewajibannya memberikan kesaksian.

Pasal 1909 ayat (3) KUH Perdata :

Segala siapa yang karena kedudukannya, pekerjaannya atau jabatannya menurut undang-undang diwajibkan merahasiakan sesuatu, namun hanyalah semata-mata mengenai hal-hal yang pengetahuannya dipercayakan kepadanya demikian.

slide401
Pasal 146 HIR ayat (1), angka 3 :

Boleh mengundurkan dirinya untuk memberi kesaksian :

Sekalian orang yang karena martabatnya, pekerjaan atau jabatan yang sah diwajibkan menyimpan rahasia, akan tetapi hanya semata-mata mengenai pengetahuan yang diserahkan kepadanya karena martabat, pekerjaan atau jabatannya itu .

(2) Kesungguhan kewajiban menyimpan rahasia yang dikatakan itu, terserah dalam pertimbangan pengadilan negeri.

slide403
Berdasar beberapan undang-undang sebagaimana terurai di atas bahwa Hak Ingkar Notaris dapat dipergunakan ketika Notaris sebagai saksi dalam perkara Perdata (Pasal 1909 ayat (3) KUHPerdata, Pasal 146 ayat (1) HIR, Pasal 277 HIR) dan Pasal 170 KUHAP) dalam persidangan pengadilan yang berkaitan dengan akta yang dibuat di hadapan atau oleh Notaris dan segala keterangan yang diperoleh dalam pembuatan akta tersebut.
kewajiban ingkar verschonings plicht
KewajibanIngkar (Verschoningsplicht)

KewajibanIngkarsuatu kewajiban untuk tidak bicara yang didasarkan pada :

Pasal 4 ayat (2) UUJN,

Pasal 16 ayat (1) huruf e UUJN

Pasal 54 UUJN.

slide405
Pasal 4 ayat (2) UUJN :

Sumpah/janjisebagaimanadimaksudpadaayat (1) berbunyisebagaiberikut:

“Sayabersumpah/berjanji :

-bahwasayaakanpatuhdansetiakepada Negara Republik Indonesia, PancasiladanUndang-UndangDasar Negara Republik Indonesia Tahun 1945, Undang-UndangtentangJabatanNotarissertaperaturanperundang-undanganlainnya.

-bahwa saya akan menjalankan jabatan saya dengan amanah, jujur, saksama, mandiri, dan tidak berpihak.

-bahwa saya akan menjaga sikap, tingkah laku saya, dan akan menjalankan kewajiban saya sesuai dengan kode etik profesi, kehormatan, martabat, dan tanggung jawab saya sebagai Notaris.

-bahwa saya akan merahasiakan isi akta dan keterangan yang diperoleh dalam pelaksanaan jabatan saya.

-bahwa saya untuk dapat diangkat dalam jabatan ini, baik secara langsung maupun tidak langsung, dengan nama atau dalih apapun, tidak pernah dan tidak akan memberikan atau menjanjikan sesuatu kepada siapapun.”

slide406
Pasal 16 ayat (1)

huruf e UUJN :

Merahasiakansegalasesuatumengenaiakta yang dibuatnyadansegalaketerangan yang diperolehgunapembuatanaktasesuaidengansumpah/janjijabatan, kecualiundang-undangmenentukan lain;

slide407
Penjelasan Pasal 16 ayat (1)

huruf e UUJN :

Kewajibanuntukmerahasiakansegalasesuatu yang berhungungandenganaktadansurat-suratlainnyaadalahuntukmelindungikepentingansesamapihak yang terkaitdenganaktatersebut.

slide408
Pasal 54 UUJN :

Notarishanyadapatmemberikan, memperlihatkan, ataumemberitahukanisiakta, Grosse Akta, SalinanAktaatauKutipanAkta, kepada orang yang berkepentinganlangsungpadaakta, ahliwaris, atau orang yang memperolehhak, kecualiditentukan lain olehperaturanperundang-undangan.

slide409
UUJN MENEMPATKAN KEWAJIBAN INGKAR NOTARIS  SEBAGAI SUATU KEWAJIBAN NOTARIS (Pasal 4 ayat (2) UUJN, Pasal 16 ayat (1) huruf e UUJN, Pasal 54 UUJN)
kapankah notaris menggunakan kewajiban hak ingkar
KAPANKAH NOTARIS MENGGUNAKAN KEWAJIBAN/HAK INGKAR ?

Dalam hal ini timbul pertanyaan, kapan kewajiban/hak ingkar dapat dilakukan ? Kewajiban/hak ingkar dapat dilakukan dengan batasan sepanjang Notaris diperiksa oleh instansi mana saja yang berupaya untuk meminta pernyataan atau keterangan dari Notaris yang berkaitan dengan akta yang telah atau pernah dibuat oleh atau di hadapan Notaris yang bersangkutan.

slide411
A. PERGUNAKAN HAK INGKAR KETIKA NOTARIS DIPERIKSA SEBAGAI SAKSI DI PENGADILAN (DALAM PERKARA PERDATA/PIDANA).

KETIKA NOTARIS DIPANGGIL PENGADILAN UNTUK BERSAKSI BERKAITAN DENGAN AKTA YANG DIBUAT OLEH/DIHADAPANNYA ATAU BERKAITAN DENGAN PELAKSANAAN TUGAS JABATAN NOTARIS BERDASARKAN UUJN  MAKA NOTARIS WAJIB MEMENUHI PANGGILAN TERSEBUT.

pasal 244 kuhpidana
PASAL 244 KUHPIDANA

Barangsiapadipanggilsebagaisaksi, ahli, ataujurubahasamenurutundang-undangdengansengajatidakmemenuhikewajibanberdasarkanundang-undang yang harusdipenuhinya, diancam :

  • Dalamperkarapidana, denganpidanapenjara paling lama sembilanbulan.
  • Dalamperkara lain, denganpidanapenjara paling lama enambulan
pasal 522 kuhp
PASAL 522 KUHP

Barangsiapa menurut undang-undang dipanggil sebagai saksi, ahli atau juru bahasa, tidak datang secara melawan hukum, diancam dengan pidana denda paling banyak sembilan ratus rupiah.

slide414
Denganancamanpidanasebagaimanatersebutdiatas, sudahtentuNotariswajibmemenuhipanggilantersebut, tapiketikapanggilantersebutdipenuhi, apakahNotarisakanmemberikanketerangan/bersaksi (tidakmempergunakanhakingkar) atauakanmempergunakanhakingkar ?.
slide415
BahwapenggunaanHakIngkartersebutketikaNotarissebagaisaksidalampersidanganpengadilantidakbersifatsertamerta, artinyalangsungberlaku. Tapijikanotarisakanmempergunakanhakingkarnya, wajibdatangdanmemenuhipanggilantersebutdanwajibmembuatsuratpermohonankepada hakim yang mengadili/memeriksaperkaratersebut, bahwaNotarisakanmenggunakanHakIngkarnya. AtaspermohonanNotaris, Hakim yang memeriksaperkara yang bersangkutanakanmenetapkanapakahmengabulkanataumenolakpermohonanNotaristersebut ?
slide416
JIKA NOTARIS AKAN MEMPERGUNAKAN HAK INGKARNYA  WAJIB MEMBUAT SURAT PERMOHONAN KEPADA HAKIM YANG MENGADILI/MEMERIKSA PERKARA TERSEBUT.

HAKIM AKAN MENETAPKAN APAKAH MENGABULKAN ATAU MENOLAK PERMOHONAN TERSEBUT.

(LIHAT PASAL 170 AYAT (1) DAN (2) KUHAP).

slide417
JIKA HAKIM MENGABULKAN PERMOHONAN NOTARIS TERSEBUT  MAKA NOTARIS TIDAK PERLU BERSAKSI.

JIKA HAKIM MENOLAK PERMOHONAN NOTARIS TERSEBUT  MAKA NOTARIS PERLU BERSAKSI. DAN ATAS KETERANGAN SAKSI DI PENGADILAN, JIKA ADA YANG DIRUGIKAN ATAS KETERANGAN NOTARIS, NOTARIS TIDAK DAPAT DITUNTUT BERDASARKAN PASAL 322 AYAT (1) KUHP  KARENA NOTARIS MELAKUKANNYA ATAS PERINTAH HAKIM.

slide418
B. PERGUNAKAN KEWAJIBAN INGKAR KETIKA DIPERIKSA SEBAGAI SAKSI/ MEMBERIKAN KETERANGAN DALAM PROSES PENYIDIKAN.

KETIKA NOTARIS DIPANGGIL/DIMINTA UNTUK BERSAKSI /MEMBERIKAN KETERANGAN AKTA AKTA YANG DIBUAT OLEH/DIHADAPAN NOTARIS ATAU PELAKSANAAN TUGAS JABATAN NOTARIS MENURUT UUJN , MENJADI KEWAJIBAN HUKUM NOTARIS UNTUK MEMENUHI HAL TERSEBUT.

slide419
PADA SAAT NOTARIS MEMENUHI PANGGILAN TERSEBUT KE HADAPAN PENYIDIK, NOTARIS DAPAT MENYATAKAN AKAN MENGUNAKAN KEWAJIBAN INGKARNYA SEBAGAIMANA DIATUR DALAM PASAL 4 AYAT (2), PASAL 16 AYAT (1) HURUF e DAN 54 UUJN. PERNYATAAN TERSEBUT DICATAT DALAM BERITA ACARA PEMERIKSAAN.
slide420
PERNYATAAN MENGGUNAKAN KEWAJIBAN INGKAR TERSEBUT TIDAK PERLU DISERTAI ALASAN APAPUN. TAPI SEMATA-MATA MENJALANKAN PERINTAH UU/UUJN.
slide421
JIKA NOTARIS MENGGUNAKAN KEWAJIBAN INGKAR, APAKAH PENYIDIK/KEJAKSAAN/HAKIM AKAN MEMAKSAKAN KEHENDAKNYA KEPADA NOTARIS DAN MENGANCAM NOTARIS DENGAN ANCAMAN MENGHALANGI PROSES PENYIDIKAN/PERADILAN ?(PASAL 117 AYAT (1) KUHAP “KETERANGAN TERSANGKA DAN/ATAU SAKSI KEPADA PENYIDIK DIBERIKAN TANPA TEKANAN DARI APAPUN DAN/ATAU DALAM BENTUK APAPUN”)
slide422
C. PERGUNAKAN KEWAJIBAN INGKAR KETIKA MEMBERIKAN KETERANGAN/ SAKSI DI HADAPAN MAJELIS PENGAWAS NOTARIS.

APAKAH NOTARIS DAPAT MENGGUNAKAN KEWAJIBAN INGKARNYA KETIKA DIPERIKSA/MEMBERIKAN KETERANGAN DI HADAPAN MAJELIS PENGAWAS NOTARIS BERKAITAN DENGAN ADANYA LAPORAN/PENGADUAN MASYARAKAT KEPADA MAJELIS PENGAWAS NOTARIS (MPD – MPW – MPP)…..?

slide423
SESAAT SETELAH NOTARIS DISUMPAH/MENGANGKAT SUMPAH SEBAGAI NOTARIS, MAKA PADA JABATANNYA TELAH PULA MELEKAT (ANTARA LAIN) KEWAJIBAN INGKAR (PASAL 4 AYAT (2), PASAL 16 AYAT (1) HURUF e DAN 54 UUJN)  SEHINGGA PADA SETIAP WAKTU/TEMPAT/DIMANAPUN NOTARIS DAPAT MEMPERGUNAKAN KEWAJIBAN INGKAR TERSEBUT.
slide424
Berdasarkan UUJN/UNDANG-UNDANG YANG LAINNYA ada beberapa peluang Notaris untuk diperiksa berkaitan dengan akta yang dibuat oleh atau di hadapannya, oleh :
  • MPD, MPW dan MPP untuk melaksanakan kewenangan Majelis Pengawas.
  • Penyidik, Kejaksaan dan Hakim.
slide425
Pada semua instansi tersebut (MPD, MPW, MPP dan Penyidik) gunakanlah Kewajiban Ingkar Notaris.

Ketika Notaris sebagai saksi di persidangan (dalam perkara pidana atau perdata) gunakanlah

Hak Ingkar Notaris.

slide426
Pada semua instansi tersebut Kewajiban/Hak Ingkar dilakukan oleh Notaris. Ketika Notaris melakukan Kewajiban Ingkar, maka instansi yang melakukan pemeriksaan tidak perlu bertanya alasannya kenapa Notaris melakukannya, tapi karena perintah UUJN. Dan jika dilakukan maka instansi yang bersangkutan wajib membuat berita acara pemeriksaan yang intinya Notaris telah melakukan Kewajiban/Hak Ingkar, dan tidak perlu lagi diupayakan lagi dengan cara-cara yang tidak sesuai dengan UUJN, misalnya dengan cara memanggil dan memeriksa Saksi Akta.
slide427
DALAM KETENTUAN

UNDANG-UNDANG (SUBSTANSI PASAL/AYAT) TERSEBUT DI ATAS, TIDAK DISEBUTKAN SECARA TERUKUR DAN NORMATIF

ALASAN-ALASAN BAGI NOTARIS UNTUK MEMPERGUNAKAN ATAU TIDAK MEMPERGUNAKAN HAK/KEWAJIBAN INGKAR. KECUALI UNDANG-UNDANG MENENTUKAN LAIN.

slide428
ALASAN-ALASAN UNTUK MEMPERGUNAKAN ATAU TIDAK MEMPERGUNAKAN HAK/KEWAJIBAN INGKAR TERGANTUNG PADA NOTARIS YANG BERSANGKUTAN.

SITUASI DAN NUANSA KETIKA AKTA DIBUAT DAN DALAM PELAKSANAAN TUGAS JABATAN NOTARIS, MAKA NOTARIS YANG BERSANGKUTAN LEBIH TAHU

slide429
JIKA NOTARIS DALAM MENJALANKAN TUGAS JABATANNYA SESUAI DENGAN UUJN  MAKA NOTARIS TELAH MENJALANKAN TUGAS/PERINTAH JABATANNYA  PASAL 50 KUHP MENENTUKAN “BARANG SIAPA MELAKUKAN PERBUATAN UNTUK MELAKSANAKAN KETENTUAN UNDANG-UNDANG TIDAK DIPIDANA”  KEPADA YANG BERSANGKUTAN (NOTARIS) TIDAK DIPIDANA.
perhatian
PERHATIAN……!!!!

NOTARIS YANG MELANGGAR KETENTUAN HAK/KEWAJIBAN INGKAR, AKAN DIKENAI/DIJATUHI SANKSI (SECARA KUMULATIF) BERUPA :

1 a sanksi pidana
1 A. SANKSI PIDANA

Pasal 322 ayat 1 KUHP :

………pidanapenjara paling lama sembilanbulanataupidanadenda paling banyaksembilanribu rupiah.

Habib Adjie-Notaris-PPAT-PL II Surabaya

1 b sanksi pidana dan denda pasal 85 undang undang nomor 43 tahun 2009 tentang kearsipan
1 B. SANKSI PIDANA DAN DENDA(PASAL 85 UNDANG-UNDANG NOMOR 43 TAHUN 2009 TENTANG KEARSIPAN )

BAHWA AKTA (PROTOKOL NOTARIS) MERUPAKAN MILIK NEGARA YANG DISIMPAN NOTARIS.

KERAHASIAAN PROTOKOL NOTARIS MENJADI TANGGUNG JAWAB DAN KEWAJIBAN NOTARIS DAN PEMEGANG PROTOKOLNYA UNTUK SELALU DIJAGA DAN DIPELIHARA SAMPAI KAPANPUN JUGA, BAHKAN SAMPAI DIA MENINGGAL DUNIA PUN RAHASIA TERSEBUT HARUS TETAP TERJAGA DAN DILANJUTKAN PENJAGAANNYA OLEH PEMEGANG PROTOKOL TERSEBUT.

Habib Adjie-Notaris-PPAT-PL II Surabaya

slide433
DALAM PERATURAN PERUNDANG-UNDANGAN TENTANG ARSIP NEGARA YAITU PASAL 66 UNDANG-UNDANG NOMOR 43 TAHUN 2009 TENTANG KEARSIPAN YANG MENENTUKAN MASA WAKTU DALUWARSA KERAHASIAAN ARSIP SELAMA 25 TAHUN, SETELAH MASA TERSEBUT MAKA ARSIP-ARSIP YANG TERSIMPAN TELAH KEHILANGAN AZAS KERAHASIAANNYA DAN BOLEH DIBUKA KEPADA UMUM.

Habib Adjie-Notaris-PPAT-PL II Surabaya

slide434
AZAS KERAHASIAAN ARSIP MENURUT UNDANG-UNDANG NOMOR 43 TAHUN 2009 TENTANG KEARSIPAN, PENCIPTA ARSIP TERSEBUT WAJIB MERAHASIAKANNYA SEBAGAIMANA DIMAKSUD DALAM PASAL 44 UU NOMOR 43 TAHUN 2009 TERSEBUT, YAKNI :

Habib Adjie-Notaris-PPAT-PL II Surabaya

slide435
(1) Penciptaarsipdapatmenutupaksesatasarsipdenganalasanapabilaarsipdibukauntukumumdapat:

a. menghambat proses penegakan hukum;

b. mengganggu kepentingan pelindungan hak atas kekayaan intelektual dan pelindungan dari persaingan usaha tidak sehat;

c. membahayakan pertahanan dan keamanan negara;

d. mengungkapkan kekayaan alam Indonesia yang masuk dalam kategori dilindungi kerahasiaannya;

Habib Adjie-Notaris-PPAT-PL II Surabaya

slide436
e. merugikan ketahanan ekonomi nasional;

f. merugikan kepentingan politik luar negeri dan hubungan luar negeri;

g. mengungkapkan isi akta autentik yang bersifat pribadi dan kemauan terakhir ataupun wasiat seseorang kecuali kepada yang berhak secara hukum;

h. mengungkapkan rahasia atau data pribadi; dan

i. mengungkap memorandum atau surat-surat yang menurut sifatnya perlu dirahasiakan.

Habib Adjie-Notaris-PPAT-PL II Surabaya

slide437
(2) Pencipta arsip wajib menjaga kerahasiaan arsip tertutup sebagaimana dimaksud pada ayat (1).

(3) Pencipta arsip wajib menentukan prosedur berdasarkan standar pelayanan minimal serta menyediakan fasilitas untuk kepentingan pengguna arsip.

Habib Adjie-Notaris-PPAT-PL II Surabaya

slide438
PELANGGARAN TERHADAP KETENTUAN ATAS KEWAJIBAN UNTUK MENJAGA KERAHASIAAN ARSIP TERSEBUT AKAN DIPIDANA DENGAN PIDANA PENJARA PALING LAMA 5 (LIMA) TAHUN SEBAGAIMANA DIMAKSUD DALAM UNDANG-UNDANG NOMOR 43 TAHUN 2009 TERSEBUT PASAL 85 YANG BERBUNYI, SEBAGAI BERIKUT :

Habib Adjie-Notaris-PPAT-PL II Surabaya

slide439
”SETIAP ORANG YANG DENGAN SENGAJA TIDAK MENJAGA KERAHASIAAN ARSIP TERTUTUP SEBAGAIMANA DIMAKSUD DALAM PASAL 44 AYAT (2) DIPIDANA DENGAN PIDANA PENJARA PALING LAMA 5 (LIMA) TAHUN ATAU DENDA PALING BANYAK RP. 250.000.000,00 (DUA RATUS LIMA PULUH JUTA RUPIAH).”

Habib Adjie-Notaris-PPAT-PL II Surabaya

catatan
CATATAN :

MESKIPUN PROTOKOL NOTARIS MERUPAKAN ARSIP NEGARA NAMUN TIDAK TUNDUK PADA KETENTUAN MENGENAI ADANYA BATASAN WAKTU KEWAJIBAN MENJAGA RAHASIA. DALAM PERATURAN PERUNDANG-UNDANGAN TENTANG ARSIP NEGARA YAITU PASAL 66 UNDANG-UNDANG NOMOR 43 TAHUN 2009 TENTANG KEARSIPAN YANG MENENTUKAN MASA WAKTU DALUWARSA KERAHASIAAN ARSIP SELAMA 25 TAHUN, SETELAH MASA TERSEBUT MAKA ARSIP-ARSIP YANG TERSIMPAN TELAH KEHILANGAN AZAS KERAHASIAANNYA DAN BOLEH DIBUKA KEPADA UMUM. NAMUN PROTOKOL NOTARIS SEBAGAI ARSIP NEGARA TIDAK BOLEH DIBUKA DAN TETAP MENJADI RAHASIA SAMPAI KAPANPUN JUGA. KECUALI UNDANG-UNDANG MENENTUKAN LAIN.

Habib Adjie-Notaris-PPAT-PL II Surabaya

2 sanksi perdata
2. SANKSI PERDATA

BERDASARKAN PASAL 1365 KUHPerdata SEBAGAI PERBUATAN MELAWAN HUKUM  GUGATAN GANTI KERUGIAN.

Habib Adjie-Notaris-PPAT-PL II Surabaya

3 sanksi administratif
3. SANKSI ADMINISTRATIF

Pasal 85 UUJN :

Pelanggaranketentuansebagaimanadimaksuddalam ..........pasal 16 ayat (1) huruf e, ............

Pasal 54, ............ dapatdikenaisanksiberupa :

  • teguranlisan;
  • tegurantertulis;
  • pemberhentiansementara;
  • pemberhentiandenganhormat; atau
  • pemberhentiandengantidakhormat.

Habib Adjie-Notaris-PPAT-PL II Surabaya

4 sanksi kode etik notaris
4. SANKSI KODE ETIK NOTARIS

BAB III

KEWAJIBAN, LARANGAN DAN PENGECUALIAN

Kewajiban

Pasal 3

Habib Adjie-Notaris-PPAT-PL II Surabaya

slide444
17. Melakukanperbuatan-perbuatan yang secaraumumdisebutsebagaikewajibanuntukditaatidandilaksanakanantara lain namuntidakterbataspadaketentuan yang tercantumdalam:
  • UU Nomor 30 Tahun 2004 tentangJabatanNotaris;
  • PenjelasanPasal 19 ayat (2) UU Nomor 30 Tahun 2004 tentangJabatanNotaris;
  • IsiSumpahJabatanNotaris;
  • AnggaranDasardanAnggaranRumahTanggaIkatanNotaris Indonesia.

Habib Adjie-Notaris-PPAT-PL II Surabaya

slide445
Larangan

Pasal 4

15.Melakukan perbuatan-perbuatan lain yang secara umum disebut sebagai pelanggaran terhadap Kode Etik Notaris, antara lain namun tidak terbatas pada pelanggaran-pelanggaran terhadap :

Habib Adjie-Notaris-PPAT-PL II Surabaya

slide446
Ketentuan-ketentuan dalam Undang-undang Nomor 30 Tahun 2004 tentang Jabatan Notaris;
  • Penjelasan Pasal 19 ayat (2) Undang-Undang Nomor 30 tahun 2004 tentang Jabatan Notaris;
  • Isi sumpah jabatan Notaris;
  • Hal-hal yang menurut ketentuan Anggaran Dasar, Anggaran Rumah Tangga dan/atau Keputusan-keputusan lain yang telah ditetapkan oleh organisasi Ikatan Notaris Indonesia tidak boleh dilakukan oleh anggota.

Habib Adjie-Notaris-PPAT-PL II Surabaya

slide447
BAB IV

S A N K S I

Pasal 6

1. Sanksi yang dikenakanterhadapanggota yang melakukanpelanggaranKodeEtikdapatberupa :

  • Teguran;
  • Peringatan;
  • Schorsing (pemecatansementara) darikeanggotaanPerkumpulan;
  • Onzetting (pemecatan) darikeanggotaanPerkumpulan;
  • PemberhentiandengantidakhormatdarikeanggotaanPerkumpulan.

Habib Adjie-Notaris-PPAT-PL II Surabaya

slide448
2.Penjatuhan sanksi-sanksi sebagaimana terurai di atas terhadap anggota yang melanggar Kode Etik disesuaikan dengan kwantitas dan kwalitas pelanggaran yang dilakukan anggota tersebut

Habib Adjie-Notaris-PPAT-PL II Surabaya

slide449
Timbulpertanyaan, apakahHakdanKewajibanIngkartersebuthanyauntukNotaris, NotarisPengganti, NotarisPenggantiKhusus, danPejabatSementaraNotarissaja ? BagaimanadenganSaksiAkta (danmantanSaksiAkta), pensiunan/werda/mantanNotaris, NotarisPengganti, NotarisPenggantiKhusus, danPejabatSementaraNotaris ? .

Habib Adjie-Notaris-PPAT-PL II Surabaya

slide450
2.Penjatuhan sanksi-sanksi sebagaimana terurai di atas terhadap anggota yang melanggar Kode Etik disesuaikan dengan kwantitas dan kwalitas pelanggaran yang dilakukan anggota tersebut
slide451
Timbulpertanyaan, apakahHakdanKewajibanIngkartersebuthanyauntukNotaris, NotarisPengganti, NotarisPenggantiKhusus, danPejabatSementaraNotarissaja ? BagaimanadenganSaksiAkta (danmantanSaksiAkta), pensiunan/werda/mantanNotaris, NotarisPengganti, NotarisPenggantiKhusus, danPejabatSementaraNotaris ?
slide452
Pasal 65 UUJN menegaskan bahwa “Notaris, Notaris Pengganti, Notaris Pengganti Khusus, dan Pejabat Sementara Notaris bertanggung jawab atas setiap akta yang dibuatnya meskipun Protokol Notaris telah diserahkan atau dipindahkan kepada pihak penyimpanan Protokol Notaris”.
slide453
Dengandemikianpensiunan/werda/mantanNotaris, NotarisPengganti, NotarisPenggantiKhusus, danPejabatSementaraNotariswajibbertanggungjawabsampaihembusan / tarikannafasterakhirmeskipunsudahtidakmenjabatlagi, danbagipensiunan/werda/mantanNotaris, NotarisPengganti, NotarisPenggantiKhusus, danPejabatSementaraNotaristetapberlakuHakdanKewajibanIngkar. UntukSanksinyadapatditerapkanPasal 322 ayat (1) KUHP dan 1365 KUHPerdata.
slide454
BagaimanadenganSaksiAktadanmantanSaksiAkta ? BahwakeberadaanSaksiAktamerupakanbagiandariaspek formal akta, tanpaadanyaSaksiAkta, makaaktaNotaristidakdapatdiperlukansebagaiaktaNotaris, tapihanyamempunyaikekuatanpembuktiansebagaiaktadibawahtangansaja (Pasal 1869 KUHPerdata). Olehkarenaitu, kedudukanSaksiAkta, mantanSaksiAktatersebuttetapmelaksanakanHakdanKewajibanIngkar.
slide455
Makapensiunan/werda/mantanNotaris, NotarisPengganti, NotarisPenggantiKhusus, danPejabatAktaNotaristidakdapatdipahamisecaraparsial, tapiharussecarakeseluruhan. SementaraNotaris, SaksiAkta, mantanSaksiAktatetapuntukmelaksanakanHakdanKewajibanIngkarsampaihembusan / tarikannafasterakhir. SanksiuntukSaksiAkta, mantanSaklsiAktadapatditerapkanPasal 322 ayat (1) KUHP dan 1365 KUHPerdata.
slide456
ADAKAH (CONTOH) SAMPAI SAAT INI UNDANG-UNDANG (PASAL/AYAT) YANG MENIADAKAN HAK/KEWAJIBAN INGKAR NOTARIS TERSEBUT ?
pasal 25 ayat 1 uu 20 2000 bphtb
Pasal 25 ayat (1) UU 20/2000 (BPHTB)

Pejabat Pembuat Akta Tanah/Notaris dan Kepala Kantor Lelang Negara melaporkan pembuatan akta atau Risalah Lelang perolehan hak atas tanah dan atau bangunan kepada Direktorat Jenderal Pajak selambat-lambatnya pada tanggal 10 (sepuluh) bulan berikutnya.

undang undang republik indonesia nomor 31 tahun 1999 tentang pemberantasan tindak pidana korupsi
UNDANG-UNDANG REPUBLIK INDONESIANOMOR 31 TAHUN 1999 TENTANGPEMBERANTASAN TINDAK PIDANA KORUPSI

Pasal 35

(1) Setiaporangwajibmemberiketerangansebagaisaksiatauahli, kecualiayah, ibu, kakek, nenek, saudara kandung. Istri atau suami, anak, dan cucudariterdakwa.

(2) Orang yang dibebaskansebagaisaksisebagaimanadimaksuddalamayat (1) dapatdiperiksasebagaisaksiapabilamerekamenghendakidandisetujuisecarategasolehterdakwa.

(3) Tanpapersetujuansebagaimanadimaksuddalamayat (2), merekadapatmemberikanketerangansebagai, saksi, tanpadisumpah.

slide459
Pasal 36

Kewajiban memberikan kesaksian sebagaimana dimaksud dalam Pasal 35 berlaku juga terhadap mereka yang menurut pekerjaan, harkat dan martabat atau jabatannya diwajibkan menyimpan rahasia, kecuali petugas agama yang menurut keyakinannya harus menyimpan rahasia.

slide460
PASAL 35 AYAT (2)

Dalamhalpihak-pihaksebagaimanadimaksudpadaayat (1) terikatolehkewajibanmerahasiakan, untukkeperluanpemeriksaan, penagihanpajak, ataupenyidikantindakpidanadibidangperpajakan, kewajibanmerahasiakantersebutditiadakan, kecualiuntuk bank, kewajibanmerahasiakanditiadakanataspermintaantertulisdariMenteriKeuangan.

i

UNDANG-UNDANG REPUBLIK INDONESIANOMOR 28 TAHUN 2007TENTANGPERUBAHAN KETIGA ATAS UNDANG-UNDANG NOMOR 6 TAHUN 1983TENTANG KETENTUAN UMUM DAN TATA CARA PERPAJAKAN

perlindungan apa yang paling aman
Perlindungan Apa Yang Paling Aman?
  • Self Defense Jalankan amanah profesi dengan profesional dan bermartabat sesuai dengan peraturan perundangan, kode etik, nilai-nilai agama;
  • Hindari praktik menyimpang  akta secara back dated, pemalsuan identitas, penyelundupan hukum, delik ommissionis (delik pasif/pembiaran/pura-pura tidak tahu)
  • Benteng Pengaman  Penggunaan CCTV, Dokumentasi Rapi, Kehadiran Saksi-Saksi, Sidik Jari, Check and Recheck, dll.

(Wakil Menteri Hukum dan HAMProf. Denny Indrayana, S.H.,LL.M.,Ph.D.

Jakarta, 2 Juli 2013)

kuliah 12

KULIAH 12

KAPITA SELEKTA UUJN

slide463
PENGGUNAAN LAMBANG NEGARA ”GARUDA PANCASILA” OLEH NOTARIS
  • Dalam Pasal 1 angka 2 Undang-undang Nomor 24 Tahun 2009 Tentang Bendera, Bahasa, dan Lambang Negara, serta Lagu Kebangsaan, disebutkan bahwa Lambang Negara Kesatuan Republik Indonesia yang selanjutnya disebut Lambang Negara adalah Garuda Pancasila dengan semboyan Bhineka Tunggal Ika.
slide464
Pasal 52 Undang-undang Nomor 24 Tahun 2009 menegaskan Lambang Negara digunakan :
    • sebagai cap atau kop surat jabatan;
    • sebagai cap dinas untuk kantor;
    • pada kertas bermeterai;
    • pada surat dan lencana gelar pahlawan, tanda jasa, dan tanda kehormatan;
    • sebagai lencana atau atribut pejabat negara, pejabat pemerintah atau warga negara Indonesia yang sedang mengemban tugas negara di luar negeri.
    • dalam penyelenggaraan peristiwa resmi;
    • dalam buku dan majalah yang diterbitkan oleh Pemerintah;
    • dalam buku kumpulan undang-undang; dan/atau
    • di rumah warga negara Indonesia.
slide465
Pasal 54 ayat (1) Undang-undang Nomor 24 Tahun 2009 mengatur mengenai penggunaan Lambang Negara sebagai cap atau kop surat jabatan sebagaimana dimaksud dalam Pasal 52 huruf a digunakan oleh :
slide466
Presiden dan Wakil Presiden.
  • Majelis Permusyawaratan Rakyat;
  • Dewan Perwakilan Rakyat;
  • Dewan Perwakilan Daerah;
  • Mahkamah Agung dan badan peradilan;
  • Badan Pemeriksa Keuangan;
  • Menteri dan pejabat setingkat menteri;
  • Kepala perwakilan Republik Indonesia di luar negeri yang berkedudukan sebagai duta besar luar biasa dan berkuasa penuh, konsul jendral, konsul, dan kuasa usaha tetap, konsul jendral kehormatan, dan konsul kehormatan;
  • Gubernur, bupati atau walikota;
  • Notaris, dan
  • Pejabat negara lainnya yang ditentukan oleh undang-undang.
slide467
Dalam Pasal 54 ayat (2) Undang-undang Nomor 24 Tahun 2009 diatur pula mengenai penggunan Lambang Negara sebagai cap dinas untuk kantor sebagaimana dimaksud dalam Pasal 52 huruf b digunakan untuk kantor :
slide468
Presiden dan Wakil Presiden.
  • Majelis Permusyawaratan Rakyat;
  • Dewan Perwakilan Rakyat;
  • Dewan Perwakilan Daerah;
  • Mahkamah Agung dan badan peradilan;
  • Badan Pemeriksa Keuangan;
  • Menteri dan pejabat setingkat menteri;
  • Kepala perwakilan Republik Indonesia di luar negeri yang berkedudukan sebagai duta besar luar biasa dan berkuasa penuh, konsul jendral, konsul, dan kuasa usaha tetap, konsul jendral kehormatan, dan konsul kehormatan;
  • Gubernur, bupati atau walikota;
  • Notaris, dan
  • Pejabat negara lainnya yang ditentukan oleh undang-undang.
slide469
Bahwa dengan demikian ada batasan dalam penggunaan Lambang Negara tersebut, bahkan dapat dijatuhi pidana, jika penggunaan Lambang Negara tersebut tidak sesuai dengan ketentuan sebagtaimana tersebut di atas sebagaimana diatur dalam Pasal 69 ditegaskan bahwa dipidana dengan pidana penjara paling lama 1 (satu) tahun atau denda paling banyak Rp. 100.000,000,00 (seratus juta) rupiah, setiap orang (huruf c) : dengan sengaja menggunakan Lambang Negara untuk keperluan lain selain yang diatur dalam Undang-undang ini.
slide470
Notaris dalam menjalankan tugas Jabatanya menggunakan Lambang Negara (Pasal 16 ayat (1) huruf k Undang-undang Jabatan Notaris) dan penggunaan Lambang Negara oleh Notaris untuk CAP atau KOP SURAT JABATAN (Pasal 54 ayat (1) huruf j Undang-undang Nomor 24 Tahun 2009) dan sebagai CAP DINAS KANTOR (Pasal 54 ayat (2) huruf j Undang-undang Nomor 24 Tahun 2009).
slide471
Berdasarkan ketentuan Pasal 54 ayat (1) huruf j dan sebagai Pasal 54 ayat (2) huruf j Undang-undang Nomor 24 Tahun 2009, penggunaan Lambang Negara oleh Notaris secara terbatas untuk Cap atau Kop Surat Jabatan, dan Cap Dinas Kantor (Notaris) saja. Hal ini dapat ditafsirkan dalam bentuk :
slide472
Cap atau Stempel NotarisKop Surat Jabatan atau Kop Surat Notaris (Kantor Notaris)Untuk Jilid atau Kover atau Sampul Salinan/Kutipan/Grosse Akte.

Bahwa Cap atau Stempel Notaris dapat dipergunakan atau diterakan pada :

  • Akta Notaris dan Salinannya.
  • Akta dibawah tangan yang didaftar.
  • Akta dibawah tangan yang dilregalisasi.
  • Coppie Collatione,
  • Pengesahan fotocopy dengan surat aslinya.
  • Dan Lambang Garuda dapat dipakai pada Kop Surat Jabatan dan Cap atau stempelnya pada Surat Jabatan.
slide473
Sekarang ini ditemukan kenyataan, bahwa penggunaan Lambang Negara oleh Notaris pada :
    • Kartu Nama (bersama-sama dengan mencantumkan jabatan lain, misalnya Pejabat Pembuat Akta Tanah (PPAT);
    • Kop Surat ((bersama-sama dengan mencantumkan jabatan lain, misalnya Pejabat Pembuat Akta Tanah (PPAT);
    • Amplop ((bersama-sama dengan mencantumkan jabatan lain, misalnya Pejabat Pembuat Akta Tanah (PPAT);
    • Kuitansi ((bersama-sama dengan mencantumkan jabatan lain, misalnya Pejabat Pembuat Akta Tanah (PPAT);
    • Map dan blocknote (bersama-sama dengan mencantumkan jabatan lain, misalnya Pejabat Pembuat Akta Tanah (PPAT);
    • Jilid atau Kover Akta ((bersama-sama dengan mencantumkan jabatan lain, misalnya Pejabat Pembuat Akta Tanah (PPAT);
    • Pulpen atau Cendera Mata dari Notaris yang bersangkutan karena telah membuat akta padanya.
slide474
Berdasarkan uraian di atas, ternyata ada batasan dalam penggunaan dan siapa yang boleh menggunakan Lambang Negara dan ada pidananya bagi yang menggunakan tidak sesuai dengan ketentuan tersebut.
slide475
Di luar intansi pemerintah dan atau negara, hanya Notaris yang menggunakan Lambang Negara. Bahwa Notaris menggunakan Lambang Negara, karena sebagai suatu Jabatan. Jadi salah kaprah dan tidak mengerti, jika ada Notaris menempatkan dirinya sebagai suatu Profesi, tidak ada di dunia ini profesi menggunakan Lambang Negara, yang boleh menggunakan Lambang Negara dalam kualifikasi sebagai Jabatan, antara lain Notaris.
slide476
Kesalahan lainnya yang perlu diluruskan, penggunaan Lambang Negara bersama dengan mencantumkan Jabatan lain, misalnya PPAT, memang salah kaprah, karena PPAT tidak memakai Lambang Negara dan tidak punya lambang apapun. Kesalahan ini telah berjalan dan berlangsung lama dan akut, seakan-akan menjadi yang benar. Dan juga ternyata Majelis Pengawas Notaris (MPD, MPW dan MPP) dalam Cap dan Kop Suratnya memakai Lambang Negara, padahal secara limitatif, tidak ada ketentuan Majelis Pengawas Notaris boleh menggunakan Lambang Negara, oleh karena itu Majelis Pengawas Notaris untuk segera mengakhiri penggunaan Lambang Negara dalam Cap dan Kop Suratnya.
slide477
Dalam tataran hukum yang benar, bahwa Lambang Negara tersebut harus digunakan secara tersendiri (tanpa menyebutkan atau bersamaan dengan Jabatan lain, selain Notaris) pada :
slide478
Kop Surat Jabatan atau Kop Surat Notaris (Kantor Notaris).
  • Untuk Jilid atau Kover atau Sampul Salinan/Kutipan/Grosse Akte.
  • Cap atau Stempel Notaris dapat dipergunakan atau diterakan pada :
  • Akta Notaris dan Salinannya.
  • Akta dibawah tangan yang didaftar.
  • Akta dibawah tangan yang dilregalisasi.
  • Coppie Collatione,
  • Pengesahan fotocopy dengan surat aslinya.
  • dan Lambang Garuda dapat dipakai pada Kop Surat Jabatan dan Cap atau stempelnya pada Surat Jabatan Notaris.
slide479
Kalaupun Notaris ingin mencantumkan jabatan Notaris dengan jabatan lainnya, misalnya PPAT pada map Notaris (bukan jilid atau sampul atau kover akta) ataupun pada kop surat, tidak perlu mencantumkan Lambang Negara dan tidak perlu menggunakan stempel Lambang Negara, buat dan gunakan stempel lain yang tidak memuat Lambang Negara.
slide480
Penggunaan Lambang Negara oleh Notaris yang meluas dan melebar yang tidak sesuai dengan ketentuan dalam Undang-undang tersebut di atas atauuntuk keperluan lain selain yang diatur dalam Undang-undang ini dapat dikategorikan sebagai suatu tindak pidana, dan kepada pelakunya dapat dijatuhi pidana sebagaimana diatur dalam Pasal 69 Undang-undang Nomor 24 Tahun 2009, dengan alasan, antara lain penggunanan Lambang Negara pada :
slide481
Kartu Nama (bersama-sama dengan mencantumkan jabatan lain, misalnya Pejabat Pembuat Akta Tanah (PPAT), ataupun hanya mencantumkan nama Notaris saja.
  • Kop Surat ((bersama-sama dengan mencantumkan jabatan lain, misalnya Pejabat Pembuat Akta Tanah (PPAT);
  • Amplop ((bersama-sama dengan mencantumkan jabatan lain, misalnya Pejabat Pembuat Akta Tanah (PPAT);
  • Kuitansi.
  • Map dan blocknote ((bersama-sama dengan mencantumkan jabatan lain, misalnya Pejabat Pembuat Akta Tanah (PPAT); ataupun hanya mencantumkan nama Notaris saja.
  • Jilid atau Kover Akta ((bersama-sama dengan mencantumkan jabatan lain, misalnya Pejabat Pembuat Akta Tanah (PPAT);
  • Pulpen atau Cendera Mata dari Notaris yang bersangkutan karena telah membuat akta padanya.
slide482
MENGENAI PENGGUNAAN

LAMBANG NEGARA (LIHAT PUTUSAN MK

Nomor 4/PUU-X/2012 :

Bahwa PENGGUNAAN Lambang Negara yang tidak sesuai sebagaimana tersebut dalam Undang-Undang Nomor 24 Tahun 2009 tentang Bendera, Bahasa, dan Lambang Negara, serta Lagu Kebangsaan (Lembaran Negara Republik Indonesia Tahun 2009 Nomor 109, Tambahan Lembaran Negara Repulik Indonesia Nomor 5035)  TIDAK DILARANG

DAN TIDAK DIKENAI PIDANA DENDA

DAN PENJARA.

slide483
1.1. Pasal 57 huruf d Undang-Undang Nomor 24 Tahun 2009 tentang Bendera, Bahasa, dan Lambang Negara, serta Lagu Kebangsaan (Lembaran Negara Republik Indonesia Tahun 2009 Nomor 109, Tambahan Lembaran Negara Repulik Indonesia Nomor 5035) bertentangan dengan UUD 1945;
slide484
1.2. Pasal 69 huruf c Undang-Undang Nomor 24 Tahun 2009 tentang Bendera, Bahasa, dan Lambang Negara, serta Lagu Kebangsaan (Lembaran Negara Republik Indonesia Tahun 2009 Nomor 109, Tambahan Lembaran Negara Repulik Indonesia Nomor 5035) bertentangan dengan UUD 1945;
slide485
1.3. Pasal 57 huruf d Undang-Undang Nomor 24 Tahun 2009 tentang Bendera, Bahasa, dan Lambang Negara, serta Lagu Kebangsaan (Lembaran Negara Republik Indonesia Tahun 2009 Nomor 109, Tambahan Lembaran Negara Repulik Indonesia Nomor 5035) tidak mempunyai kekuatan hukum mengikat;
slide486
1.4. Pasal 69 huruf c Undang-Undang Nomor 24 Tahun 2009 tentang Bendera, Bahasa, dan Lambang Negara, serta Lagu Kebangsaan (Lembaran Negara Republik Indonesia Tahun 2009 Nomor 109, Tambahan Lembaran Negara Repulik Indonesia Nomor 5035) tidak mempunyai kekuatan hukum mengikat;
slide487
NOTARIS (PPAT)

SEBAGAI SAKSI AKTA, TEPATKAH…?

slide488
Akhir-akhir ini makin banyak saja para Notaris (PPAT) menjadi Saksi dalam perkara Perdata atau Pidana yang berkaitan dengan akta yang dibuat di hadapan (akta pihak) dan oleh (akta relaas) Notaris sendiri (bukan sebagai saksi ahli). Bahkan saksi aktapun diperlakukan seperti itu, artinya jika atas permintaan pihak tertentu (Penyidik, Kejaksaan, Pengadilan) MPD tidak mengizinkan Notaris untuk diperiksa, maka pihak yang bersangkutan, akan membidik saksi-saksi yang tersebut dalam akta, dengan keterangan yang diperoleh dari saksi akta tersebut, berharap dapat memeriksa Notaris yang bersangkutan. Padahal seharusnya dipahami, sebuah akta Notaris tidak boleh diperlakukan secara parsial di hadapan hukum, tapi harus dipahami secara menyeluruh, mulai dari awal akta sampai akhir akta, dengan kata lain pemanggilan saksi akta tersebut membuktikan ketidakmampuan pihak-pihak tertentu tersebut dalam memahami akta Notaris.
slide489
Atas kejadian tersebut memprihatinkan, karena dunia Notaris dan produk dari pelaksanaan tugas jabatan Notaris, antara lain akta, telah disalahkaprahi oleh para Notaris dan pihak lainnya yang berkecimpung dalam dunia hukum. Notaris yang menjadi saksi atas akta tersebut di atas, seakan-akan Notaris telah menjadi pihak dalam akta (misalnya sebagai tergugat dalam perkara perdata) dan sebagai saksi atau terdakwa dalam perkara pidana dengan kualifikasi tuduhan/dakwaan sebagai yang menyuruh melakukan, pelaku penyuruh atau turut serta melakukan.
slide490
Bahwa Notaris bukan pihak dalam akta, meskipun dalam akta ada nama dan tanda tangan Notaris, para pihak datang ke hadapan Notaris untuk membuat akta tertentu keinginan para pihak sendiri, tanpa diminta atau disuruh Notaris, tanpa ada permintaan dari para pihak Notaris tidak akan pernah membuat akta apapun, jika permintaan tersebut dipenuhi, maka tugas Notaris sesuai kewenangannya, yaitu membuat akta tersebut dengan memperhatikan aspek lahir, formal dan materil sesuai aturan hukum yang mengatur pelaksanaan tugas jabatan Notaris.
slide491
Sehingga jika suatu akta Notaris bermasalah, apakah permasalahan tersebut timbul dari aspek lahir, formal atau materil akta tersebut ? Atau apakah karena para pihak sendiri yang tidak mau menjalankan akta

tersebut ? Contoh, ada akta pengikatan jual-beli, yang pembelian tersebut dilakukan secara angsuran tiap bulan dalam jumlah tertentu selama 1 (satu) tahun, dan dibuat dengan klausul denda dan lain-lainnya, ternyata kemudian pembeli wanprestasi, dan yang dilakukan penjual mengadukan pembeli kepada kepolisian dan menyeret Notaris yang membuat akta tersebut dan secara pidana dengan kualifikasi turut serta melakukan atau menyuruh melakukan ? Atau digugat secara perdata ? Aneh bukan ?, tapi ini ada/terjadi.

slide492
Bahwa secara lahiriah, formal dan materil akta tersebut tidak ada masalah apapun dan telah benar menurut hukum yang mengatur kenotarisan, tapi masalah yang terjadi yaitu, salah satu pihak tidak mau melaksanakan isi akta tersebut, kesalahan ada pihak pembeli, jika hal ini bukan kesalahan Notaris. Artinya kejadian seperti berkaitan dengan hak kewajiban para pihak yang harus dilaksanakan oleh para pihak sendiri.
slide493
Dalam praktek banyak ditemukan, jika akta bermasalah (tanpa melihat apa kesalahan dari aspek lahir, formal atau materil) atau karena kesalahan para pihak sendiri yang tidak mau taat terhadap akta yang pernah dibuat oleh Notaris, maka pihak yang merasa dirugikan, disamping melaporkan pihak yang lainnya, juga sering pula melaporkan Notarisnya untuk perkara pidana, dan juga menempatkan Notaris sebagai tergugat (turut tergugat) dalam perkara perdata.
slide494
Dalam kontruksi hukum yang benar (berdasarkan Pasal 84 UUJN), jika permasalahan karena akta tidak memenuhi aspek lahir, formal dan materil, maka pihak yang namanya tersebut dalam akta dapat mengajukan gugatan atau menggugat Notaris yang bersangkutan, dengan kewajiban, bahwa akta yang bersangkutan karena kesalahan lahir, formal dan materil telah menimbulkan kerugian yang nyata sebagai dari akta tersebut, maka pihak tersebut dapat menggugat Notaris yang bersangkutan, agar akta tersebut didegradasikan menjadi akta di bawah tangan atau mempunyai kekuatan pembuktian sebagai akta dibawah tangan. Jika hal tersebut terbukti, dan Notaris dibebani kewajiban untuk membayar ganti kerugian kepada penggugat, dan agar gugatan tidak sia-sia dapat diletakan sitaan atas seluruh harta kekayaan Notaris, jika setelah disita dan dilelang ternyata seluruh harta Notaris tidak memenuhi untuk membayar seluruh ganti kerugian tersebut, maka Notaris yang bersangkutan dapat dinyatakan pailit, dan atas kepailitan Notaris tersebut dapat dijadikan dasar untuk memberhentikan Notaris yang bersangkutan.
slide495
Tapi jika akta memenuhi aspek lahir, formal dan materil, dan tidak ada kesalahan apapun dari akta Notaris, dan akta tidak dapat dijalankan karena para pihak tidak mau melakukkanya, maka pihak yang bersangkutan dapat datang kembali kepada Notaris untuk :
slide496
membatalkan akta tersebut atau mengatur kembali substansi akta tersebut atas kesepakatan para pihak dengan akta Notaris lagi, atau
  • jika tidak disepakati, salah satu pihak dapat mengajukan gugatan ke pengadilan negeri untuk menggugat pihak yang lainnya, dengan substansi gugatan untuk menyatakan akta tersebut tidak mengikat para pihak lagi.
slide497
Dalam kaitan ini, dapatkan Notaris dijadikan tersangka atau terdakwa berkaitan dengan akta yang dibuat di hadapan atau oleh Notaris ? Untuk ini perlu diberi batasan, yaitu jika dalam pembuatan akta Notaris tersebut, disadari, diinsyafi dan ada konspirasi antara para pihak yang menghadap Notaris dan Notaris dalam membuat akta yang bersangkutan sengaja untuk menguntungkan pihak tertentu atau untuk merugikan pihak lain atau untuk melakukan suatu tindak pidana. Jika hal ini dapat dibuktikan, maka Notaris seperti ini wajib untuk mempertanggungjawabkannya secara pidana. Tapi tindakan seperti tidak akan terjadi, jika Notaris yang bersangkutan menyadari dirinya sendiri dalam melaksanakan tugas jabatannya, tapi jika ada yang melakukan, maka Notaris tersebut telah membunuh dirinya sendiri.
slide498
Sekarang ini terjadi, tanpa memperdulikan batas-batasan seperti tersebut di atas, yang penting seret saja Notarisnya. Hal ini terjadi karena :
  • Para Notaris tidak memahami pelaksanaan tugasnya sendiri.
  • Pihak lainnya (diluar Notaris) tidak memahami dunia dan maka Notaris dalam melaksanakan tugasnya.
slide499
Batasan lainnya yang juga perlu diperhatikan, bahwa Notaris bertanggungjawab secara hukum selama yang bersangkutan masih menjalankan tugas jabatannya, jika sudah pensiun, maka tidak perlu ada pertanggungjawabannya lagi. Hal ini dapat dipahami bahwa fokus Notaris ada pada aspek lahir, formal dan materil, dan pelaksanaan tugas jabatan Notaris secara biologis sudah berakhir untuk Notaris yang bersangkutan, tapi secara yuridis akta terus tetap berjalan atau akta Notaris mempunyai umur yuridis selama dunia belum kiamat, oleh karena itu maka salinan akta Notaris masih dapat dikeluarkan oleh Notaris pemegang protokolnya, bahkan akta yang sudah dibatalkan oleh para pihak sendiri atau dibatalkan oleh pengadilan, salinan aktanya masih dapat dikeluarkan oleh Notaris yang bersangkutan atau oleh Notaris pemegang protokolnya atas permintaan para pihak atau ahli warisnya. Inilah makna akta Notaris mempunyai kekuatan pembuktian yang sempurna (dalam kesempurnaan juga mempunyai kekuatan pembuktian yang kuat).
slide500
Jika eksistensi Notaris dan akta Notaris disalahkaprahi oleh Notaris sendiri dan juga oleh para pihak lainnya, maka siap-siaplah eksistensi Notaris Indonesia akan berada pada titik nadir, dan kesalahkaprahan tersebut dilakukan juga oleh Menteri Hukum dan Hak Asasi Manusia Republik Indonesia yang pada tanggal 8 November 2007 Menteri Hukum dan Hak Asasi Manusia Republik Indonesia mengeluarkan Peraturan Menteri Hukum dan Hak Asasi Manusia Republik Indonesia nomor : M.03.HT.03.10. Tahun 2007 Tentang Pengambilan Minuta Akta dan Pemanggilan Notaris.
slide501
Memang seharusnya dalam pertemuan ilmiah para Notaris dari tingkat daerah, wilayah dan pusat melalu kegiatan upgrading dan refreshing course hanya membahas materi yang sifatnya aplikatif atau implementasi dari suatu aturan hukum, dan ini tidak salah untuk dilakukan, tapi juga harus dikaji/dibahas yang sifatnya mendasar, misalnya mengenai prinsip, norma atau azas-azas dalam dunia Notaris.
slide502
Untuk rekan-rekan para Notaris, mari disamping kita bertindak secara egois dan ini memang sifat dasar manusia, yaitu untuk membangun kantornya sendiri agar laku, penghasilan (uang) meningkat dari hari-kehari, menabung sebanyak-banyaknya, tapi kita juga harus membangun kelembagaan Notaris. Jika diibaratkan, lembaga Notariat adalah bangunan rumah para Notaris bernaung, berteduh, dan kita para Notaris para penghuninya. Dalam sebuah rumah sudah tentu ada pondasi, tiang, dinding, atap, kusen dan asesoris yang lainnya, jika rumah kita bocor, rusak mari kita perbaiki, dan yang harus memperbaiki kita semua para Notaris. Kita perkuat kelembagaan Notaris dengan prinsip, norma, azas-azas yang dapat menunjang pelaksanaan tugas jabatan Notaris. Adanya kejadian yang memprihatinkan seperti diuraikan di atas, menunjukkan prinsip, norma dan azas-azas dalam dunia Notaris belum dapat dipahami oleh para Notaris atau memang belum ada. (kalau ada yang sudah tahu, tolong saya diberitahu oleh rekan-rekan).
slide504
Kehadiran Majelis Pengawas Daerah seperti yang diatur dalam Pasal 66 UUJN telah memberikan harapan mengenai seharusnya seperti apa Notaris dan akta Notaris dinilai oleh insitusi yang memahami dan mengerti Notaris. Sudah tentu dalam melakukan pemeriksaan Notaris atas permintaan Penyidik, Penuntut Umum atau Hakim untuk kepentingan proses peradilan, MPD akan bersidang dan menilai tindakan Notaris dan akta Notaris yang bersangkutan berdasarkan Undang-undang Jabatan Notaris (UUJN) dan Hukum Kenotariatan Indonesia.
slide505
Ketika MPD tidak mengizinkan seorang Notaris untuk memenuhi panggilan Penyidik, Penuntut Umum atau Hakim dengan alasan Notaris yang bersangkutan dalam membuat akta telah sesuai dengan prosedur pembuatan akta yang benar berdasarkan UUJN, maka untuk Notaris yang bersangkutan telah selesai perbuatan hukumnya, artinya, akta yang dibuat oleh atau di hadapan Notaris telah memenuhi syarat lahir, formal dan materil.
slide506
Dalam praktek sekarang ini banyak ditemukan suatu kenyataan, ketika seorang Notaris oleh MPD tidak diizinkan untuk memenuhi panggilan Penyidik, Penuntut Umum, Hakim, maka (khususnya Penyidik dari Kepolisian) akan berupaya untuk mencari cara atau celah lain, dengan maksud untuk memperoleh kebenaran materil, dan yang dilakukan oleh Penyidik yaitu memanggil saksi-saksi akta. atau membidik saksi-saksi yang tersebut dalam akhir akta, dengan keterangan yang diperoleh dari saksi akta tersebut, berharap dapat memeriksa Notaris yang bersangkutan atau terkadang dibalik para saksi akta dipanggil terlebih dahulu, setelah mendapat keterangan dari para saksi tersebut, kemudian Penyidik akan memanggil Notarisnya melalui MPD. Sehingga apakah yang dilakukan oleh Penyidik, hakim atau Kejaksaan sesuatu yang benar menurut UUJN ? Apakah ini berarti telah terjadi membuka rahasia jabatan Notaris melalui Saksi Akta ?
slide507
Kita bisa membayangkan tidak akan ada kepastian hukum, jika saksi dalam akta Notaris diperlakukan seperti itu, dan selama hidupnya saksi akta akan dihantui pemanggilan oleh penyidik entah kapan saja, tidak menutup kemungkinan ketika mantan saksi tersebut sudah tua renta tanpa daya dan upaya dipanggil sebagai saksi oleh Penyidik.
slide508
Saksi secara umum. Saksi ada 2 (dua), yaitu : (1) mereka yang secara kebetulan melihat, mendengar sendiri peristiwa-peristiwa yang jadi persoalan, dan (2) saksi-saksi yang pada waktu perbuatan hukum dilakukan sengaja telah diminta untuk menjadi saksi. Menurut Pasal 171 HIR bahwa yang diterangkan oleh saksi adalah apa yang ia lihat, dengar atau rasakan sendiri, lagi pula tiap-tiap kesaksian harus disertai alasan-alasan apa sebabnya, bagaimana ia sampai mengetahui hal-hal yang diterangkan olehnya. Perasaan yang istimewa, yang terjadi karena akal, tidak dipandang sebagai penyaksian.
slide509
Kedudukan Saksi Akta Notaris berbeda dengan saksi pada umumnya sebagaimana tersebut di atas. Selain Akta Notaris atau saksi pada umumnya merupakan saksi yang mendengar, melihat sendiri suatu peristiwa yang terjadi, misalnya jika terjadi jual beli dan dilakukan penyerahan uang pembelian dari pembeli kepada penjual, maka secara fisik saksi tersebut melihat sendiri peristiwa tersebut. Tapi dalam saksi akta, jika para pembeli telah menyerahkan uang pembelian kepada penjual yang dilakukan transfers antar bank, yang hanya dapat dibuktikan dengan bukti transfers, kemudian akta jual belinya di hadapan Notaris, apakah sama pengetahuan saksi pada kedua peristiwa hukum tersebut mengenai penyerahan uang pembelian ?
slide510
Maka saksi selain saksi akta mengetahui dengan betul peristiwa hukum yang terjadi dalam transaksi tersebut, sedangkan saksi akta tidak tahu apapun tentang penyerahan uang tersebut secara fisik. Berdasarkan ilustrasi sederhana tersebut bahwa kedudukan saksi akta Notaris merupakan perintah undang-undang (UUJN) untuk memenuhi syarat formal akta Notaris.
slide511
Saksi Akta Notaris merupakan para saksi yang ikut serta di dalam pembuatan terjadinya akta (instrumen), maka dari itulah disebut Saksi Instrumentair (Instrumentaire Getuigen). Mereka dengan jalan membubuhkan tanda tangan mereka, memberikan kesaksian tentang kebenaran adanya dilakukan dan dipenuhinya formalitas-formalitas yang diharuskan oleh UUJN, yang disebutkan dalam akta tersebut.
slide512
Bahwa salah satu syarat formal akta Notaris sebagaimana tersebut dalam Pasal 38 UUJN, dan mengenai Saksi (Saksi Instrumentair) ini ditegaskan dalam Pasal 38 ayat (4) huruf c UUJN, bahwa pada akhir atau penutup akta harus memuat nama lengkap, tempat dan tanggal lahir, pekerjaan, jabatan, kedudukan, dan tempat tinggal dari tiap-tiap saksi. Ketika syarat formal ini tidak dipenuhi, maka akta tersebut terdegradasi kedudukannya menjadi mempunyai kekuatan pembuktian sebagai akta dibawah tangan (Pasal 1869 – 1870 KUHPerdata).
slide513
Secara keseluruhan akta Notaris, akan disebut akta Notaris lengkap jika semua syarat formal tersebut dipenuhi sehingga mempunyai kekuatan pembuktian yang sempurna, sehingga kedudukan saksi akta yang merupakan salah satu syarat formal sudah dipertanggungjawabkan secara hukum, oleh karena itu ketika Notaris oleh MPD tidak diperkenankan untuk memenuhi panggilan Penyidik, yang berarti akta tersebut telah benar secara hukum. Oleh karena itu tidak perlu lagi Penyidik mengambil tindakkan hukum lain, dengan cara memanggil saksi akta untuk diminta keterangan, yang dari keterangan saksi akta tersebut akan dikonfrontasikan dengan Notarisnya atau sebaliknya saksi aktanya dipanggil terlebih dahulu, kemudian dipanggil Notarisnya dan nanti diknfrontasikan dengan keterangan saksi akta. Cara apapun yang dilakukan tersebut sudah tidak sesuai dengan UUJN dan Hukum Kenotaritan Indonesia.
slide514
Notaris merupakan jabatan kepercayaan, hal ini mengandung makna, yaitu mereka yang menjalankan tugas jabatan dapat dipercaya dan karena jabatan Notaris sebagai jabatan kepercayaan, sehingga jabatan Notaris sebagai jabatan kepercayaan dan orang yang menjalankan tugas jabatan juga dapat dipercaya yang keduanya saling menunjang. Oleh karena itu Notaris dalam menjalankan tugas jabatannya punya kewajiban merahasiakan segala sesuatu mengenai akta yang dibuatnya dan segala keterangan yang diperoleh guna pembuatan akta sesuai dengan sumpah/janji jabatan, kecuali undang-undang menentukan lain (Pasal 16 ayat (1) huruf e UUJN).
slide515
Ditegaskan pula dalam Penjelasan huruf e bahwa kewajiban untuk merahasiakan segala sesuatu yang berhubungan dengan akta dan surat-surat lainnya adalah untuk melindungi kepentingan semua pihak yang terkait dengan akta tersebut. Sudah menjadi kewajiban Notaris untuk mempertahankan rahasia jabatan tersebut, karena bagaimana jadinya Notaris akan disebut sebagai jabatan yang dipercaya, ternyata rahasia jabatan kepercayaan tersebut dapat dibongkar oleh Penyidik melalui keterangan Saksi Akta yang dipanggil oleh Penyidik ?. Bagi Notaris sendiri melakukan pelanggaran terhadap pasal tersebut dapat dijatuhi sanksi sebagaimana tersebut dalam Pasal 85 UUJN.
slide516
Padahal seharusnya dipahami, sebuah akta Notaris tidak boleh diperlakukan secara parsial di hadapan hukum, tapi harus dipahami secara menyeluruh (holistic-integral), mulai dari awal akta sampai akhir akta, dengan kata lain pemanggilan saksi akta tersebut membuktikan ketidakmampuan pihak-pihak tertentu tersebut dalam memahami akta Notaris, dengan kata lain pemanggilan saksi akta yang tersebut dalam akhir akta tersebut merupakan suatu penyimpangan dan kesalahkaprahan dan tidak perlu dilakukan dan telah terjadi pembongkaran rahasia melalui pemanggilan dan keterangan dari Saksi Akta.
slide517
Berdasarkan uraian di atas, dapat kita mengerti, jika mereka yang namanya dalam akta sebut karena tidak mau melaksanakan isi akta atau ada pihak yang dirugikan bukan dengan cara menyeret Notaris dan para Saksi Akta kepada kepolisian atau Penyidik. Tapi aktanya yang menjadi dasar, karena akan terjadi ketidakkonsistenan dalam pembuktian, ketika Notaris dan Saksi Aktanya masih hidup, maka Notaris dan Saksi Aktanya akan dimintai keterangan, tapi ketika Notaris dan Saksi Aktanya sudah meninggal dunia, sudah tidak mungkin lagi dimintai keterangan, kecuali dibuat Berita Acara Pemeriksaan (BAP) di atas batu nisan yang bersangkutan. Oleh karena itu fokusnya pada aktanya, bukan mempersoalkan Notaris dan Saksi Akta. Jadi sangat tidak sesuai atau bertentangan dengan UUJN jika Penyidik, Hakim, Kejaksaan memanggil Saksi Akta, karena Saksi Akta merupakan bagian yang tidak terpisahkan dari formalitas-formalitas akta Notaris sebagai akta otentiik.
slide519
Dalam Penjelasan Umum UUJN ditegaskan bahwa peraturan perundang-undangan yang mengatur tentang Notaris sudah tidak sesuai lagi dengan perkembangan dan kebutuhan hukum masyarakat Indonesia. Oleh karena itu, perlu diadakan pembaharuan dan pengaturan kembali secara menyeluruh dalam satu undang-undang yang mengatur tentang Jabatan Notaris sehingga tercipta suatu unifikasi hukum yang berlaku untuk semua penduduk di seluruh wilayah negara Republik Indonesia. Dalam rangka mewujudkan unifikasi hukum di bidang kenotariatan tersebut dibentuk Undang-undang tentang Jabatan Notaris.
slide520
UUJN sebagai buatan manusia sudah tentu belum memuaskan semua pihak, terutama untuk Notaris, oleh karena itu terlepas dari lengkap atau tidak lengkap, puas atau tidak puas suatu undang-undang, apapun isinya harus kita terima dulu, seandainya ada kekuranglengkapan dapat ditambah ataupun diperbaiki.
slide521
Dengan kehadiran UUJN tersebut saat sekarang ini merupakan satu-satunya undang-undang yang mengatur Notaris Indonesia, yang berarti telah terjadi unifikasi hukum dalam bidang pengaturan Notaris. Sehingga UUJN dapat disebut sebagai penutup (pengaturan) masa lalu dunia Notaris Indonesia dan pembuka (pengaturan) dunia Notaris Indonesia masa datang. Sekarang UUJN saja yang merupakan “rule of law” untuk dunia Notaris Indonesia.
ad