SYSTEM PENCERNAAN - PowerPoint PPT Presentation

system pencernaan n.
Download
Skip this Video
Loading SlideShow in 5 Seconds..
SYSTEM PENCERNAAN PowerPoint Presentation
Download Presentation
SYSTEM PENCERNAAN

play fullscreen
1 / 43
SYSTEM PENCERNAAN
1206 Views
Download Presentation
selene
Download Presentation

SYSTEM PENCERNAAN

- - - - - - - - - - - - - - - - - - - - - - - - - - - E N D - - - - - - - - - - - - - - - - - - - - - - - - - - -
Presentation Transcript

  1. SYSTEM PENCERNAAN MATA KULIAH : ANATOMI FISIOLOGI

  2. Pengertian • Sistempencernaan (sistemgastroinstestinal) adalahsistem organ dalammanusia yang berfungsiuntuk : • menerimamakanan • mencernanyamenjadizat-zatgizidanenergi, • menyerapzat-zatgizikedalamalirandarahserta • membuangbagianmakanan yang tidakdapatdicernaataumerupakansisaprosestersebutdaritubuh

  3. ProsesPencernaan • Pencernaanfisik/mekanis • Merupakanprosesperubahanmolekulmakanan yang besarmenjadikecil-kecil, misalnyapenghancuranmakanandengangigiataudenganototlambung • Pencernaankimiawi • Merupakanprosesperubahanmolekul-molekulbahanorganik yang adadalambahanmakanandaribentuk yang kompleksmenjadimolekul yang lebihsederhanadenganbantuanenzim

  4. Organ Pencernaan

  5. Salurancerna • Mulut (oris) • Tenggorokan/ faring/ tekak • Kerongkongan/ Esofagus • Lambung (ventrikulus) • Usushalus (intestinum minor), terdiridari : Duodenum (usus 12 jari), Jejenumdan Ileum • Ususbesar (intestinum mayor), terdiridari : Sekum, Kolonasendens, Kolontransversum, Kolondesendens, Kolon sigmoid • Rektum • Anus Organ PencernaanTambahan: • Gigi/ geligi • Lidah • Kelenjarludah • Kandungempedu • Hati • Pankreas

  6. Bagianronggamulut • Bagianluar yang sempitatauvestibulaterdiridariruangantaragusi, gigi, bibirdanpipi • Bagiandalamdilapisiolehselaputlendir. Yang dibatasiolehtulangmaksilaris, palatumdanmandibularis, disebelahbelakangbersambungdgn faring.

  7. Ronggamulut

  8. Pencernaandalamronggamulut • Pencernaanmekanik: • pengunyahanolehgigi (mencampurmakanandgn air ludahsehinggaterbentuk bolus. • Pencernaankimiawi: • pemecahanzatpati/ amilumolehptialin/amilasemenjadimaltosa.

  9. Gigi • Gigisulung, mulaitumbuhpadaanak-anakumur 6-7 bulan. Lengkappadaumur 2½ tahun, jumlahnya20 buah, disebutjugagigisusu, terdiridari: 4 buahgigitaring (dens kaninus), 8 buahgigiseri (dens insisivus) dan 8 buahgigigeraham (molare). • Gigitetap (gigipermanen) tumbuhpadaumur 6-18 tahun, jumlahnya32 buah, terdiridari: 12 buahgigiseri (dens insisivus), 4 buahgigitaring, 8 buahgigigerahambelakang (molare) dan 8 buahgigigerahamdepan (premolare). • Fungsigigi: • Gigiseri (memotongdanmenggigitmakanan) • Gigitaring (memutuskan/ merobekmakanan yang kerasdanliat) • Gigigeraham (mengunyah/ menggilingmakanan yang sudahdipotong-potong).

  10. Lidah • Lidahterdiridariototseratlintang/ lurik (ototsadar, dapatdigerakkankeseluruharah), dilapisiselaputlendir. • Lidahterbagi 3 bagian: • Radiks lingua (pangkallidah) : terdapatEpiglotis yang berfungsimenutupjalannafassaatmenelan. • Dorsum lingua (punggunglidah) : terdapatujungsarafpengecap • Apeks lingua (ujunglidah) • Fungsilidah : mengadukmakanan, membentuksuara, sebagaialatpengecapdanmenelansertamerasakanmakanan.

  11. Kelenjarludah • Kelenjarparotis: terletakdisebelahbawahdepandauntelinga, diantaraototprosesus mastoid kiridankanandengankulitpipi. Cairanludahhasilsekresidikeluarkanmelaluiduktusstensenkedalamronggamulut. • Kelenjarsublingualis: terletakdibawahlidah, salurannya (duktusrinvus) menujulantaironggamulut. • Kelenjarsubmandibularis: terletaklebihkebelakangdankesampingdarikelenjar sublingual. Salurannya (duktuswharton) menujulantaironggamulut

  12. Fig 25.6

  13. Kelenjarludah Semuakelenjarludahmenghasilkan air ludah (saliva) untukmembasahironggamulutdanmakanan Kira-kira 1600 cc saliva disekresikansetiaphari. Lebih 99% saliva terdiridari air, sisanyaterdiridarigaram, urea, lendir, bikarbonat, lisozim (enzimpenghancurbakteri) danamilase (ptialin). Ptialinbekerjadironggamulut (PH 6,3-6,8) danmasihbekerjadidalamlambung ± 15 menitsampaiasamlambungmenurunkan PH dantidakbekerja. Yang dapatmerangsangpengeluaran saliva adalahrangsanganparasimpatis, adanyamakanandironggamulut, membaui, melihatdanmemikirkanmakanan, suaramemasak.

  14. Faring • Faring merupakan organ yang menghubungkanronggamulutdengankerongkongan (esofagus), yang panjangnya ± 7 cm. • Ada 3 bagian faring: • Nasofaring : bagian superior (bagian yang samatinggidenganhidung) • Orofaring : bagian media (bagian yang samatinggidenganmulut), terdapatamandel/ tonsil didinding lateral orofaring. • Laringofaring : bagian inferior (bagian yang samatinggidenganlaring)

  15. Esofagus Dari mulut, makananmenujuesofagus / kerongkongan. Kerongkonganberupatabungotot yang panjangnyasekitar 25 cm. Terdiridari 1/3 ototlurikdan 2/3 ototpolos. Olehkarenaototnyatersusunsecaramemanjangdanmelingkarmakajikaterjadikontraksisecarabergantianakanterjadigerakan peristaltic  makananterdorongmenujulambung.

  16. Gaster / lambung • Lambungmerupakan organ ototberongga yang besar. • Letaknyadibawahdiafragmadidepanpankreasdanlimpa, agakkesebelahkiri. Kapasitaslambung 1-2 liter. • Lapisanlambungdaridalamkeluar: • Selaputlendir; padakeadaankosongberlipat-lipat, disebutjugarugae • Lapisanototsirkuler/ muskulusaurikularis • Lapisanotot miring/ muskulusobliqua • Lapisanototmemanjang/ muskulus longitudinal • Lapisanjaringanikat/ serosa

  17. BagianGaster • Fundus / bagian yang menonjolkeatas • Korpus / badan • Antrumpilorus ; membentuksfingterpilorus • Kurvatura minor: disisikananlambung • Kurvatura mayor: disisikirilambung, lebihpanjangdarikurvatura minor • Osteumkardiak

  18. Bagianlambung

  19. Fungsilambung • Motoris : • Menampungmakanan, menghancurkandanmenghaluskanmakananolehperistaltiklambungdangetahlambung • Sekresienzimpencernaan: • Enzim Pepsin : memecah protein  asam amino (albumin danpepton). • EnzimRenin : membentuk protein susu (kasein) • HCL berfungsi : • mengasamkanmakanan, • desinfektan, • merangsangkeluarnyahormonsekretin yang merangsangpankreasmengeluarkansekretnya, • mengaktifkanPepsinogenmenjadi Pepsin, • merangsanghormonKolesistokinin yang merangsangempedumengeluarkangetahnya • Enzim Lipase (sdkt): memecahlemakasamlemak, gliserida • Sekresifaktorintrinsik : Vit B12 berfungsidalampembentukaneritrosit • Sekresimukusberfungsimelindungisel-sellambungdarikerusakanoleh HCL

  20. USUS HALUS • Usushalusatauintestinum minor merupakanbagian yang berpangkalpadapilorus, yang panjangnya ± 6 meter, merupakansaluran paling panjang. • FungsiUsushalus: • Menerimazat-zatmakanan yang sudahdicernauntukdiserapmelaluikapilerdarahdansaluranlimfe • Menyerap protein dalambentukasam amino • Karbohidratdiserapdalambentukmonosakarida

  21. Getahusus • Padamukosausushalusterdapatkelenjar yang menghasilkangetahusus yang menyempurnakanmakanan: • Enterokinase: mengaktifkanenzimproteolitikdarigetahpankreas • Eripsinmenyempurnakanpencernaan protein menjadiasam amino. • Laktasemengubahlaktosamenjadimonosakarida • Maltose mengubahmaltosamenjadimonosakarida • Sukrosemengubahsukrosamenjadimonosakarida

  22. Bagianusushalus • Duodenum (usus 12 jari) • Jejenum • Ileum

  23. Lapisanusushalusdaridalamkeluar • Lapisanmukosa • Lapisanototsirkuler/ muskulussirkuler • Lapisanototmemanjang/ muskulus longitudinal • Lapisanserosa

  24. UsusHalus

  25. Duodenum Duodenum = usus 12 jari. Panjangnya ± 25 cm. Di duodenum bermuaraduasaluran, yaitusalurangetahpankreasdansaluranempedu, dimanagetahkeduanyadikeluarkanke duodenum. Getahempeduberfungsimengemulsikanlemakdenganbantuan lipase. Getahpankreasmenghasilkanenzimpencernaan: Amilase (mencernahidratarangmenjadidisakarida), tripsin (mencerna protein menjadiasam amino), lipase (mencernalemakmenjadigliseroldanasamlemak).

  26. Jejenum Jejenum = ususkosong. Panjangnya ± 2-3 meter. Kelenjarususmenghasilkanenzimpencernaansepertiygdihasilkanpankreas

  27. Ileum Ileum = ususpenyerapan. Panjangnya ± 4-5 meter. Di ileum makananakandiserapolehjonjotusus. Asam amino danglukosa, vitamin, mineral akandiangkutolehkapilerdarah, sedangasamlemakdangliserolakandiangkutolehpembuluhlimfe.

  28. Colon / ususbesar • Ususbesar/kolondilapisiolehmembranmukosatanpalipatankecualipadabagian rectum. • Fungsiutamanyaadalah : • mengabsorbsi air • membentukmassafeses • membentuklendiruntukmelumasipermukaanmukosa. • Dalamususbesarterdapatbakteriyaitu E. Coli yang hiduppadamakanan yang tidakdapatdicernaolehmanusia, misalnyaselulosadanmenghasilkan vitamin K dan biotin. Ke-2 produk yang disintesis E. coli tersebutdiserapmasukkedalamtubuhmelaluidindingkolon.

  29. Colon Jadidalamususbesartidakterjadipencernaanmekanismaupunkimia, yang terjadiadalahpenyerapan air danpembentukanfeses yang tersimpan 24 jam

  30. Colon

  31. Rektum Rektummerupakansebuahruangan yang berawaldariujungususbesar (setelahkolon sigmoid) danberakhirdi anus. Organ iniberfungsisebagaitempatpenyimpanansementarafeses. Biasanyarektuminikosongkarenatinjadisimpanditempat yang lebihtinggiyaitukolondesendens. Jikakolondesendenspenuhdantinjamasukkedalamrektumakantimbulkeinginanuntukbuang air besar (BAB). Jikadefekasitidakterjadi, sering kali material akandikembalikankeususbesar, dimanapenyerapan air akankembalidilakukan.

  32. Rektumdan anal

  33. Anus Anus merupakanlubangdiujungsaluranpencernaan, dimanabahanlimbahkeluardaritubuh. Sebagian anus terbentukdaripermukaantubuh (kulit) dansebagianlainnyadariusus. Pembukaandanpenutupan anus diaturolehototsphinkter. Fesesdibuangdaritubuhmelaluiprosesdefekasi (buang air besar - BAB), yang merupakanfungsiutama anus.

  34. Hati • Letaknyadibagianatasrongga abdomen disebelahkananbawahdiafragma, beratnya ±1,5 kg. • Fungsi : • Mengaturdistribusimakanan • GlukosaGlikogen = hatidanotot • Mengatur protein darah • Menyaringbakteridanzattoksik • Menghancurkaneritrositygmati • Mengubah pro vit A menjadivit A • Membuatempedu • Mengubah NH3 menjadiureum

  35. Kandungempedu Sebuahkantongberbentukterong, merupakanmembranberotot, letaknyadidalamlobusdisebelahpermukaanbawahhati. Panjangnya 8-12 cm, berkapasitas 60 cm3. Getahempedu, suatucairanygdisekresisetiaphariolehselhati: 500-1000 cc, meningkatsewaktumencernalemak.

  36. Pankreas • Letaknyadibelakanglambung, panjangnya ± 15 cm, lebar 5 cm, berat rata-rata 60-90 gr, strukturnyamiripkelenjarludah, bagian-bagiannya: kaput, korpusdanekor. • Hasilsekresipankreas: • Hormon insulin: dihasilkandaripulaulangerhans • Getahpankreas, mengandung: • Amilase : amilummaltosa • Lipase : lemakasamlemak + gliserol • NaHCO3 : Basa • Tripsinogen : EnterokinaseTripsin (protein Asam Amino)

  37. Prosespencernaan • Mengunyah • Makanandipotong-potongdandikunyaholehgigimenjadibagian-bagiankecil yang lebihmudahdicerna. Ludahakanmembungkusbagiandarimakanantersebutdenganenzim-enzimpencernaandanmulaimencernanyamenjadiBolus • Menelan (deglusi) • Makanandidorongmelaluikerongkonganbukanolehgayatarikbumi, tetapiolehgelombangkontraksidanrelaksasiototritmik yang disebutdenganperistaltik. seluruhprosesterjadidalam 2 detik

  38. Prosespencernaan • Makanandilambung • Pencampuran 15-20 detik • Kimus: sudahbercampurdgncairanlambung • Kontraksilapar: terjadibilalambungkosong, setelahbeberapa jam • Pengosonganlambung • Terjadikarenaperistaltik yang kuat: kontraksitoniksfingterpilorus

  39. Prosespencernaan • Pergerakanusushalusdankolon • Pergerakanlambatsaatmencampurdanmendorong (8-15 jam untukmendorongkimusdarikatupileosekalsampaikekolontransversum. • Dipermudahrefleksgastrokolikdanduodenokolik • Haustral churning: Gerakanmencampurchymeuntukmembantumengabsorpsi air. 2,5 L air diabsorbsidalam 24 jam, berlangsungselama 5 menit. • Colon Peristaltik: Gelombangmencampur yang lambatolehotot longitudinal danototsirkuler, mendorongchymeke colon

  40. Prosespencernaan • Sekresisalurancerna • Eliminasifekaladalahsampahprodukpencernaantubuhdenganhasilfeses. • Defekasiadalahkeluarnyafesesdari anus danrektum

  41. KelenjarPencernaan

  42. Terimakasih