system pencernaan n.
Skip this Video
Loading SlideShow in 5 Seconds..
SYSTEM PENCERNAAN PowerPoint Presentation
Download Presentation

Loading in 2 Seconds...

play fullscreen
1 / 43

SYSTEM PENCERNAAN - PowerPoint PPT Presentation

  • Uploaded on

SYSTEM PENCERNAAN. MATA KULIAH : ANATOMI FISIOLOGI. Pengertian. Sistem pencernaan ( sistem gastroinstestinal ) adalah sistem organ dalam manusia yang berfungsi untuk : menerima makanan mencernanya menjadi zat-zat gizi dan energi , menyerap zat-zat gizi ke dalam aliran darah serta

I am the owner, or an agent authorized to act on behalf of the owner, of the copyrighted work described.
Download Presentation

PowerPoint Slideshow about 'SYSTEM PENCERNAAN' - selene

An Image/Link below is provided (as is) to download presentation

Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author.While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server.

- - - - - - - - - - - - - - - - - - - - - - - - - - E N D - - - - - - - - - - - - - - - - - - - - - - - - - -
Presentation Transcript
system pencernaan



  • Sistempencernaan (sistemgastroinstestinal) adalahsistem organ dalammanusia yang berfungsiuntuk :
    • menerimamakanan
    • mencernanyamenjadizat-zatgizidanenergi,
    • menyerapzat-zatgizikedalamalirandarahserta
    • membuangbagianmakanan yang tidakdapatdicernaataumerupakansisaprosestersebutdaritubuh
proses pencernaan
  • Pencernaanfisik/mekanis
    • Merupakanprosesperubahanmolekulmakanan yang besarmenjadikecil-kecil, misalnyapenghancuranmakanandengangigiataudenganototlambung
  • Pencernaankimiawi
    • Merupakanprosesperubahanmolekul-molekulbahanorganik yang adadalambahanmakanandaribentuk yang kompleksmenjadimolekul yang lebihsederhanadenganbantuanenzim
saluran cerna
  • Mulut (oris)
  • Tenggorokan/ faring/ tekak
  • Kerongkongan/ Esofagus
  • Lambung (ventrikulus)
  • Usushalus (intestinum minor), terdiridari : Duodenum (usus 12 jari), Jejenumdan Ileum
  • Ususbesar (intestinum mayor), terdiridari : Sekum, Kolonasendens, Kolontransversum, Kolondesendens, Kolon sigmoid
  • Rektum
  • Anus

Organ PencernaanTambahan:

  • Gigi/ geligi
  • Lidah
  • Kelenjarludah
  • Kandungempedu
  • Hati
  • Pankreas
bagian rongga mulut
  • Bagianluar yang sempitatauvestibulaterdiridariruangantaragusi, gigi, bibirdanpipi
  • Bagiandalamdilapisiolehselaputlendir. Yang dibatasiolehtulangmaksilaris, palatumdanmandibularis, disebelahbelakangbersambungdgn faring.
pencernaan dalam rongga mulut
  • Pencernaanmekanik:
    • pengunyahanolehgigi (mencampurmakanandgn air ludahsehinggaterbentuk bolus.
  • Pencernaankimiawi:
    • pemecahanzatpati/ amilumolehptialin/amilasemenjadimaltosa.
  • Gigisulung, mulaitumbuhpadaanak-anakumur 6-7 bulan. Lengkappadaumur 2½ tahun, jumlahnya20 buah, disebutjugagigisusu, terdiridari: 4 buahgigitaring (dens kaninus), 8 buahgigiseri (dens insisivus) dan 8 buahgigigeraham (molare).
  • Gigitetap (gigipermanen) tumbuhpadaumur 6-18 tahun, jumlahnya32 buah, terdiridari: 12 buahgigiseri (dens insisivus), 4 buahgigitaring, 8 buahgigigerahambelakang (molare) dan 8 buahgigigerahamdepan (premolare).
  • Fungsigigi:
    • Gigiseri (memotongdanmenggigitmakanan)
    • Gigitaring (memutuskan/ merobekmakanan yang kerasdanliat)
    • Gigigeraham (mengunyah/ menggilingmakanan yang sudahdipotong-potong).
  • Lidahterdiridariototseratlintang/ lurik (ototsadar, dapatdigerakkankeseluruharah), dilapisiselaputlendir.
  • Lidahterbagi 3 bagian:
    • Radiks lingua (pangkallidah) : terdapatEpiglotis yang berfungsimenutupjalannafassaatmenelan.
    • Dorsum lingua (punggunglidah) : terdapatujungsarafpengecap
    • Apeks lingua (ujunglidah)
  • Fungsilidah : mengadukmakanan, membentuksuara, sebagaialatpengecapdanmenelansertamerasakanmakanan.
kelenjar ludah
  • Kelenjarparotis: terletakdisebelahbawahdepandauntelinga, diantaraototprosesus mastoid kiridankanandengankulitpipi. Cairanludahhasilsekresidikeluarkanmelaluiduktusstensenkedalamronggamulut.
  • Kelenjarsublingualis: terletakdibawahlidah, salurannya (duktusrinvus) menujulantaironggamulut.
  • Kelenjarsubmandibularis: terletaklebihkebelakangdankesampingdarikelenjar sublingual. Salurannya (duktuswharton) menujulantaironggamulut



kelenjar ludah1

Semuakelenjarludahmenghasilkan air ludah (saliva) untukmembasahironggamulutdanmakanan

Kira-kira 1600 cc saliva disekresikansetiaphari.

Lebih 99% saliva terdiridari air, sisanyaterdiridarigaram, urea, lendir, bikarbonat, lisozim (enzimpenghancurbakteri) danamilase (ptialin). Ptialinbekerjadironggamulut (PH 6,3-6,8) danmasihbekerjadidalamlambung ± 15 menitsampaiasamlambungmenurunkan PH dantidakbekerja.

Yang dapatmerangsangpengeluaran saliva adalahrangsanganparasimpatis, adanyamakanandironggamulut, membaui, melihatdanmemikirkanmakanan, suaramemasak.

  • Faring merupakan organ yang menghubungkanronggamulutdengankerongkongan (esofagus), yang panjangnya ± 7 cm.
  • Ada 3 bagian faring:
    • Nasofaring : bagian superior (bagian yang samatinggidenganhidung)
    • Orofaring : bagian media (bagian yang samatinggidenganmulut), terdapatamandel/ tonsil didinding lateral orofaring.
    • Laringofaring : bagian inferior (bagian yang samatinggidenganlaring)

Dari mulut, makananmenujuesofagus / kerongkongan.

Kerongkonganberupatabungotot yang panjangnyasekitar 25 cm.

Terdiridari 1/3 ototlurikdan 2/3 ototpolos. Olehkarenaototnyatersusunsecaramemanjangdanmelingkarmakajikaterjadikontraksisecarabergantianakanterjadigerakan peristaltic  makananterdorongmenujulambung.

gaster lambung
Gaster / lambung
  • Lambungmerupakan organ ototberongga yang besar.
  • Letaknyadibawahdiafragmadidepanpankreasdanlimpa, agakkesebelahkiri. Kapasitaslambung 1-2 liter.
  • Lapisanlambungdaridalamkeluar:
    • Selaputlendir; padakeadaankosongberlipat-lipat, disebutjugarugae
    • Lapisanototsirkuler/ muskulusaurikularis
    • Lapisanotot miring/ muskulusobliqua
    • Lapisanototmemanjang/ muskulus longitudinal
    • Lapisanjaringanikat/ serosa
bagian gaster
  • Fundus / bagian yang menonjolkeatas
  • Korpus / badan
  • Antrumpilorus ; membentuksfingterpilorus
  • Kurvatura minor: disisikananlambung
  • Kurvatura mayor: disisikirilambung, lebihpanjangdarikurvatura minor
  • Osteumkardiak
fungsi lambung
  • Motoris :
    • Menampungmakanan, menghancurkandanmenghaluskanmakananolehperistaltiklambungdangetahlambung
  • Sekresienzimpencernaan:
    • Enzim Pepsin : memecah protein  asam amino (albumin danpepton).
    • EnzimRenin : membentuk protein susu (kasein)
    • HCL berfungsi :
      • mengasamkanmakanan,
      • desinfektan,
      • merangsangkeluarnyahormonsekretin yang merangsangpankreasmengeluarkansekretnya,
      • mengaktifkanPepsinogenmenjadi Pepsin,
      • merangsanghormonKolesistokinin yang merangsangempedumengeluarkangetahnya
    • Enzim Lipase (sdkt): memecahlemakasamlemak, gliserida
  • Sekresifaktorintrinsik : Vit B12 berfungsidalampembentukaneritrosit
  • Sekresimukusberfungsimelindungisel-sellambungdarikerusakanoleh HCL
usus halus
  • Usushalusatauintestinum minor merupakanbagian yang berpangkalpadapilorus, yang panjangnya ± 6 meter, merupakansaluran paling panjang.
  • FungsiUsushalus:
    • Menerimazat-zatmakanan yang sudahdicernauntukdiserapmelaluikapilerdarahdansaluranlimfe
    • Menyerap protein dalambentukasam amino
    • Karbohidratdiserapdalambentukmonosakarida
getah usus
  • Padamukosausushalusterdapatkelenjar yang menghasilkangetahusus yang menyempurnakanmakanan:
    • Enterokinase: mengaktifkanenzimproteolitikdarigetahpankreas
    • Eripsinmenyempurnakanpencernaan protein menjadiasam amino.
    • Laktasemengubahlaktosamenjadimonosakarida
    • Maltose mengubahmaltosamenjadimonosakarida
    • Sukrosemengubahsukrosamenjadimonosakarida
bagian usus halus
  • Duodenum (usus 12 jari)
  • Jejenum
  • Ileum
lapisan usus halus dari dalam ke luar
  • Lapisanmukosa
  • Lapisanototsirkuler/ muskulussirkuler
  • Lapisanototmemanjang/ muskulus longitudinal
  • Lapisanserosa

Duodenum = usus 12 jari.

Panjangnya ± 25 cm.

Di duodenum bermuaraduasaluran, yaitusalurangetahpankreasdansaluranempedu, dimanagetahkeduanyadikeluarkanke duodenum.

Getahempeduberfungsimengemulsikanlemakdenganbantuan lipase.

Getahpankreasmenghasilkanenzimpencernaan: Amilase (mencernahidratarangmenjadidisakarida), tripsin (mencerna protein menjadiasam amino), lipase (mencernalemakmenjadigliseroldanasamlemak).


Jejenum = ususkosong.

Panjangnya ± 2-3 meter.



Ileum = ususpenyerapan.

Panjangnya ± 4-5 meter.

Di ileum makananakandiserapolehjonjotusus. Asam amino danglukosa, vitamin, mineral akandiangkutolehkapilerdarah, sedangasamlemakdangliserolakandiangkutolehpembuluhlimfe.

colon usus besar
Colon / ususbesar
  • Ususbesar/kolondilapisiolehmembranmukosatanpalipatankecualipadabagian rectum.
  • Fungsiutamanyaadalah :
    • mengabsorbsi air
    • membentukmassafeses
    • membentuklendiruntukmelumasipermukaanmukosa.
  • Dalamususbesarterdapatbakteriyaitu E. Coli yang hiduppadamakanan yang tidakdapatdicernaolehmanusia, misalnyaselulosadanmenghasilkan vitamin K dan biotin. Ke-2 produk yang disintesis E. coli tersebutdiserapmasukkedalamtubuhmelaluidindingkolon.

Jadidalamususbesartidakterjadipencernaanmekanismaupunkimia, yang terjadiadalahpenyerapan air danpembentukanfeses yang tersimpan 24 jam


Rektummerupakansebuahruangan yang berawaldariujungususbesar (setelahkolon sigmoid) danberakhirdi anus.

Organ iniberfungsisebagaitempatpenyimpanansementarafeses. Biasanyarektuminikosongkarenatinjadisimpanditempat yang lebihtinggiyaitukolondesendens.

Jikakolondesendenspenuhdantinjamasukkedalamrektumakantimbulkeinginanuntukbuang air besar (BAB). Jikadefekasitidakterjadi, sering kali material akandikembalikankeususbesar, dimanapenyerapan air akankembalidilakukan.


Anus merupakanlubangdiujungsaluranpencernaan, dimanabahanlimbahkeluardaritubuh. Sebagian anus terbentukdaripermukaantubuh (kulit) dansebagianlainnyadariusus.

Pembukaandanpenutupan anus diaturolehototsphinkter.

Fesesdibuangdaritubuhmelaluiprosesdefekasi (buang air besar - BAB), yang merupakanfungsiutama anus.

  • Letaknyadibagianatasrongga abdomen disebelahkananbawahdiafragma, beratnya ±1,5 kg.
  • Fungsi :
    • Mengaturdistribusimakanan
    • GlukosaGlikogen = hatidanotot
    • Mengatur protein darah
    • Menyaringbakteridanzattoksik
    • Menghancurkaneritrositygmati
    • Mengubah pro vit A menjadivit A
    • Membuatempedu
    • Mengubah NH3 menjadiureum
kandung empedu

Sebuahkantongberbentukterong, merupakanmembranberotot, letaknyadidalamlobusdisebelahpermukaanbawahhati.

Panjangnya 8-12 cm, berkapasitas 60 cm3.

Getahempedu, suatucairanygdisekresisetiaphariolehselhati: 500-1000 cc, meningkatsewaktumencernalemak.

  • Letaknyadibelakanglambung, panjangnya ± 15 cm, lebar 5 cm, berat rata-rata 60-90 gr, strukturnyamiripkelenjarludah, bagian-bagiannya: kaput, korpusdanekor.
  • Hasilsekresipankreas:
    • Hormon insulin: dihasilkandaripulaulangerhans
    • Getahpankreas, mengandung:
    • Amilase : amilummaltosa
    • Lipase : lemakasamlemak + gliserol
    • NaHCO3 : Basa
    • Tripsinogen : EnterokinaseTripsin (protein Asam Amino)
proses pencernaan1
  • Mengunyah
  • Makanandipotong-potongdandikunyaholehgigimenjadibagian-bagiankecil yang lebihmudahdicerna. Ludahakanmembungkusbagiandarimakanantersebutdenganenzim-enzimpencernaandanmulaimencernanyamenjadiBolus
  • Menelan (deglusi)
  • Makanandidorongmelaluikerongkonganbukanolehgayatarikbumi, tetapiolehgelombangkontraksidanrelaksasiototritmik yang disebutdenganperistaltik. seluruhprosesterjadidalam 2 detik
proses pencernaan2
  • Makanandilambung
    • Pencampuran 15-20 detik
    • Kimus: sudahbercampurdgncairanlambung
    • Kontraksilapar: terjadibilalambungkosong, setelahbeberapa jam
  • Pengosonganlambung
    • Terjadikarenaperistaltik yang kuat: kontraksitoniksfingterpilorus
proses pencernaan3
  • Pergerakanusushalusdankolon
    • Pergerakanlambatsaatmencampurdanmendorong (8-15 jam untukmendorongkimusdarikatupileosekalsampaikekolontransversum.
    • Dipermudahrefleksgastrokolikdanduodenokolik
  • Haustral churning: Gerakanmencampurchymeuntukmembantumengabsorpsi air. 2,5 L air diabsorbsidalam 24 jam, berlangsungselama 5 menit.
  • Colon Peristaltik: Gelombangmencampur yang lambatolehotot longitudinal danototsirkuler, mendorongchymeke colon
proses pencernaan4
  • Sekresisalurancerna
    • Eliminasifekaladalahsampahprodukpencernaantubuhdenganhasilfeses.
    • Defekasiadalahkeluarnyafesesdari anus danrektum