140 likes | 223 Views
Introduce bioinformatics tools to general biology students using hemoglobin. Learn about genomics, point mutations, similarities between organisms, and protein alignments.
E N D
Using Hemoglobin to Introduce Bioinformatics Tools to General Biology StudentsNancy Boury, Cristina Caldari-Farren, Scott Chirhart, Chrystal Ho Pao, Crystal Simien
Target: Intro. Bio. students (major/non-majors) • Upon completion of this activity students should be able to: • Use basic Bioinformatics tools
DNARNAProtein Synthesis Intro to Genomics How many genomes? How many genes per genome? How do you navigate in this sea of data? NCBI Ex. Pick a protein that you talked about? Hemoglobin Why?
Why Hemoglobin? • Has been introduced in General Biology • Known diseases associated with it • Typically used as example of deleterious effects of point mutations • Duplications within the human genome • Adult, fetal, myoglobin • Well conserved
How do we decide if two organisms are similar? Simple sequences DID YOU SEE THE CAT RUN DID YOU SEA THE CAT RUN DID YOO SEE TEE BAT RUT BAD OOO EEE TTT DOG SIT How are differences in similarity quantified? Intro to BLAST and how it works? Ex. Hemoglobin--Human vs. Asian Water Buffalo
How do we decide if two organisms are similar? • Alignment • Gaps-2 • (HH) MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLL • (AWB)M - -LTAEEKAAVTAFWGKVHVDEVGGEALGRLL
E-value • E-values of 10-4 and lower might indicate a significant homology. • E-values between 10-4 and 10-2 should be checked (may not be homologous). • E-values between 10-2 and 1probably do not indicate a good homology
How do we decide if two organisms are similar? Similarities between proteins in one species? Similarities between one protein in many species? How do we determine if evolutionarily linked? What questions could you ask with this data?
We can look at evolutionary linkage with the use of phylogenetic trees based on sequence data
What could we ask the students to do? • Differences in conserved vs. non-conserved proteins? • List of possible proteins: • Hexokinase • ATPase • NADH dehydrogenase • Cytochromes • Actin