keterampilan dasar kebidanan n.
Skip this Video
Loading SlideShow in 5 Seconds..
Download Presentation

Loading in 2 Seconds...

play fullscreen
1 / 42


  • Uploaded on

KETERAMPILAN DASAR KEBIDANAN. ACE INHIBITOR Dr. Danu Lestariyanto. Nama anggota. Santiningtyas ayu k. Soli rumiyati Sholihatun hasanah Sukengtyas utami Tanty hanani Titik sugiarti. Pengertian ACE Inhibitor.

I am the owner, or an agent authorized to act on behalf of the owner, of the copyrighted work described.
Download Presentation


An Image/Link below is provided (as is) to download presentation

Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author.While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server.

- - - - - - - - - - - - - - - - - - - - - - - - - - E N D - - - - - - - - - - - - - - - - - - - - - - - - - -
Presentation Transcript
keterampilan dasar kebidanan



Dr. Danu Lestariyanto

nama anggota
  • Santiningtyasayu k.
  • Soli rumiyati
  • Sholihatunhasanah
  • Sukengtyasutami
  • Tantyhanani
  • Titiksugiarti
pengertian ace inhibitor
Pengertian ACE Inhibitor

ACE inhibitor atau angiotensin-converting enzyme inhibitor, adalah kelompok obat-obatan yang digunakan terutama dalam pengobatan hipertensi dan gagal jantung kongestif.


ACE inhibitor dibagi menjadi tiga kelompok berdasarkan struktur molekul :

  • Sulfhidril yang mengandung agen
  • Captopril (perdagangan Capoten nama), penghambat ACE yang pertama
  • Zofenopril

2. Dicarboxylate yang mengandung agen (kelompokterbesar

  • Enalapril (Vasotec / Renitec)
  • Ramipril (Altace / Tritace / Ramace / Ramiwin)
  • Quinapril (Accupril)
  • Perindopril (Coversyl / Aceon)
  • Lisinopril (Lisodur / Lopril / Novatec / Prinivil / Zestril)
  • Benazepril (Lotensin)
  • Fosfonat yang mengandung agen
  • Fosinopril (Monopril) adalah satu-satunya anggota kelompok ini
1 sulfhidril yang mengandung agen
1. Sulfhidril yang mengandung agen

1.1 Captopril

  • Indikasi:

antihipertensi, left ventricular disfunctionyang disertaimyocardial infarction, diabetes nefropati, vasodilator, CHF

  • Kontrindikasi :

hipersensitivitasterhadap Captopril, angiodema yang disebabkanolehpenggunaan ACE inhibitor sebelumnya, wanitahamildanmenyusui



tablet, tablet salutselaput, tablet salutgula, kaplet, kapletsalutselaput, kapsul-tablet

Dosis: sebagaiantihipertensipada orang dewasa (oral)

  • Dosisawal :

12,5-25 mg 2-3 kali/hari yang dapatditingkatkan 12,5-25 mg dalam 1-2 minggumenjadi 50 mg 3 kali/hari

  • Dosisperawatan:

50 mg 3 kali/hari

  • Dosismaksimum:

150 mg 3 kali/hari



  • Diberikandalamkeadaanperutkosong (1 jam sebelummakanatau 2 jam setelahmakan)
  •   Captopril digunakansetelahpenggunaanantihipertensi lain dihentikanselama 1 minggu, kecualipadapasiendenganaccelerated or malignant hypertensionatauhipertensi yang sulitdikontrol
  • Pasien yang tidakdapatmenggunakansediaanpadatsecara oral dapatdibuatlarutan oral Captopril dengancaramenyerbuk 25 mg tablet Captopril yang dilarutkandalam 25 atau 100 ml air dandiadukhinggabercampurlalusegeradiminumtidaklebihdari 10 menitkarenasifat Captopril yang tidakstabildalambentuklarutan
  • Efeksamping :

ruam, berkurangnyapersepsipengecapan, sakitkepala, batukkering, hipotensisementara, neutropenia, proteinurea

2 dicarboxylate yang mengandung agen
2. Dicarboxylate yang mengandung agen

2.1 Enalapril

Tujuan/ Kegunaanobat

  • Enalaprilmerupakanubatuntukmengawaldanmerawatpenyakitdarahtinggi
  • dankegagalanjantungkongestif .
  • Membantumeningkatkanfungsiginjaldalampenyakitkencingmanis.

Cara Penggunaan

  • Dimakansekaliatau 2 kali seharimengikutarahandoktor
  • Bolehdimakanbersama-samaatautanpamakanan.
  • Adalahdinasihatkan agar mengambilpadamasa yang samasetiaphariuntuk
  • memberikesan yang optimum.
  • Dos maksimumuntukdewasaadalah 40mg setiaphari.
  • Jikaterlupamengambilubat
  • Sekiranyaterlupa, makanubatdengansegerasetelahmengingatinya.
  • Sekiranyatelahhampirkepada dos seterusnya, tinggalkan dos yang telah




  • Simpanobatjauhdaricahayadansuhutinggi.
  • Simpanobatdi tempat yang dingindankering.

Efek CV (hipotensi, angioedema)

  • Efek CNS (kelelahan, sakit kepala)
  • Efek GI (gangguan perasa)
  • Efek berturut-turut (batuk tidak berdahak; upper resp tract symptoms)
  • Efek Dermatologis (ruam, erythema multiforme, toxic epidermal necrolysis)
  • reaksi hipersensitivitas
  • Efek ginjal (kerusakan ginjal)
  • Gangguan electrolyte (hiperkalemia, hiponatremia,)
  • gangguan darah.
2 2 ramipril
2.2 Ramipril
  • Ramiprilmerupakanpenghambat angiotensin converting enzyme (ACE) generasikedua
  • Prinsipkerjadari ACE adalahmengubah angiotensin I menjadi angiotensin II
  • Ramiprilmenghambatpembentukan angiotensin II sehinggamenyebabkan:
  • Penurunanresistensivaskular.
  • Penurunanretensinatriumdan air.
  • Penurunanefektrophicdari angiotensin II padajantungdanpembuluhdarah
  • Hipertensi, dapatdigunakantunggalataudikombinasikandengandiuretiktipetiazid.
  • Gagaljantungkongestifpadabeberapaharisetelahmenderitainfarkmiokardialakut.


  • Hipersensitifterhadapobatini
  • Pasiendenganriwayat angioedema berhubungandenganpengobatansebelumnyadenganmenggunakanpenghambat ACE.


  • Dosisawaltanpapemakaiandiuretik: 2,5 mg, 1 x sehari.
  • Dosisdisesuaikandenganrespontekanandarah.
  • Dosispemeliharaanpada orang dewasa: 2,5-20 mg perhari, 1 atau 2 kali sehari. Jikarespontekanandarahberkurangdenganpemberiansekaliseharipadaakhir interval pemberianobat, dosisditingkatkanataupemberianobatdibagimenjadi 2 x sehari.
  • Bilatekanandarahtidakdapatdikontrolhanyadenganramipril, dapatditambahkandengandiuretik.


  • Padapasiendewasasetelahinfarkmiokardial yang secaraklinismenunjukkangagaljantungkongestif, terapiramiprildimulai 2 harisetelahinfarkmiokard.
  • Dosisawal: 2,5 mg, 2 x sehari, jikaterjadihipotensidosisdikurangimenjadi 1,25 mg, 2 x sehari.
  • Dosisditingkatkanhingga 5 mg, 2 x sehari.
  • Setelahpemberiandosisawalramipril, pasienharusdiawasiselama paling sedikit 2 jam, sampaitekanandarahtelahstabilselama paling sedikit 1 jam berikutnya. Untukmemperkecilkemungkinanterjadinyahipotensi, dosisdaridiuretik yang digunakanbersamaan, harusdikurangi, jikamemungkinkan. Hipotensisetelahpemberiandosisawaltidakmenghalangipenyesuaiandosis, setelahhipotensidapatdiatasi.
2 3 quinapril
2.3 Quinapril

Quinapriladalahgrupobatyang disebutangiotensin-converting enzyme (ACE) inhibitor yang digunakanuntukmengobatitekanandarahtinggi (hipertensi) ataugagaljantung.Indikasi:Untukmengobatitekanandarahtinggi (hipertensi) ataugagaljantung

  • Dosispadapasiengangguanginjal
  • Pasiendenganbersihankreatinin < 40 ml/menit/1,73 m2 (serum kreatinin > 2,5 mg/dl), dosisdiberikan 25% daridosis normal.
  • Pasienhipertensidengangangguanginjal, dosisawal 1,25 mg, 1 x sehari. Kemudiandosisditingkatkantergantungtoleransi individual danrespontekanandarahhinggadosismaksimum 5 mg perhari.
  • Pasiengagaljantungdengangangguanginjal, dosisawal 1,25 mg, 1 x sehari. Dosisdapatditingkatkanmenjadi 1,25 mg, 2 x seharidanhinggamencapaidosismaksimum 2,5 mg, 2 x seharitergantungpadaresponklinisdantolerabilitaspasien.
efek samping
  • Seluruhtubuh: reaksianafilaktoid
  • Kardiovaskular:gejalahipotensi, sinkop, angina pektoris, aritmia, nyeri dada, palpitasi, infarkmiokard, serebrovaskular.
  • Hematologi:pansitopenia, anemia hemolitik, dantrombositopenia.
  • Ginjal:peningkatan nitrogen urea dalamdarahdankreatinin serum terutamapemberianramiprilbersamadengandiuretik.
  • Edema angioneurotik:padastudiklinis 0,3% pasiendilaporkanmengalami edema angioneurotik
  • Batuk:batuk yang gatal, kering, menetapdan non produktifdilaporkanterjadidenganpenggunaanpenghambat ACE. Batukakanhilangsegerasetelahmenghentikanpengobatan.
  • Gastrointestinal:pankreatitis, sakitperut, anoreksia, konstipasi, diare, mulutkering, dispepsia, disfagia, gastroenteritis, hepatitis, mual, peningkatan air liur, gangguaninderapengecap, danmuntah.
  • Dermatologik:reaksihipersensitivitas (sepertiurtikaria, pruritus, ataurash, dengan/tanpademam), eritema, pemfigus, fotosensitivitasdanpurpura.
  • Neurologikdanpsikiatrik:Ansietas, amnesia, konvulsi, depresi, kekuranganpendengaran, insomnia, resah, neuralgia, neuropati, kesemutan, rasa kantuk, tinitus, tremor, vertigo dangangguanpenglihatan.
  • Lain-lain:Kompleksgejalapernahdilaporkan, meliputi: ANA (Antinuclear antibodies) positif,peningkatankecepatansedimentasieritrosit, artritis/artralgia, mialgia, demam, vaskulitis, eosinofilia, fotosensitivitas, rashdanmanifestasidermatologiklainnya. Terjadinyaeosinophilic pneumonitispernahdilaporkanjuga.



5 mg melaluimulut (per oral), 1 kali sehari


10-20 mg/harimelaluimulut (per oral), dalamdosisyang dibagi


40 mg/hari



  • EfekCV (hipotensi,angioedema)
  • Efek CNS (kelelahan, sakitkepala)
  • Efek GI (gangguanperasa)
  • Efeklainnya (batukkering;upperresp tract symptomps)
  • Efekdermatologis (ruamkulit, erythemamultiforme, toxic epidermal necrolysis)
  • Reaksihipersensitif: efekginjal (kerusakanginjal),gangguan electrolyte (hyperkalemia, hyponatremia);,gangguandarah.


  • Pasiendengan HF danmereka yang kekurangangaramatau air (mengalamidiuretikataudialisis) mungkinmengalamihipotensiselamatingkatanawalterapiACE inhibitor. (Mulaipengobatanhanyadalampengawasanahli; padapasieninigunakandosisrendahdanpastikanpasiendalamposisiterlentang)
  • Mulaidengandosisrendahdantingkatkandosissecarabertahapjikadosis yang lebihrendahtersebutsudahdapatditerima.
  • Hindaripadapasiendenganaortic stenosis atauoutflow tract obstructiondanbiasanyaharusdihindaripadapasien yang didugamemilikipenyakitrenovaskuleraktual (actual renovascular disease).
  • Tidakbolehdiberikanpadapasienjikapasientersebutpernahmengalamiefeksamping yang mengancamnyawa (angioedema ataugagalginjal) selamapemberianobatsebelumnya, pasienhipotensif yang beradapadarisikosedangdarisyokkardiogenik.
  • Gunakandenganhati-hatipadapasien yang memilikiriwayatketurunanatauidiophatic angioedema.
  • Periksatekanandarah (BP), fungsiginjaldanelektrolit 1-2 minggusetelahpenambahantiapdosis, padawaktu 3 bulankemudianlakukansetiap 6 bulan. (Diperlukanlebihbanyakpengawsaanpadapasien yang pernahatau yang barumengalamidisfungsiginjal)
  • NSAIDs harusdihindarikarenahaltersebutbisamenutupmanfaatdanmeningkatkanefeksampingdariACE inhibitordanmungkinsecarasinergismembahayakanfungsiginjal.
2 4 perindopril

Perindopril adalahjenisobat yang disebut ACE (angiotensin converting enzyme) inhibitors. Perindopril bekerjadengancaramenghalangi ACE, yaituenzim yang terlibatdalampenyempitanpembuluhdarahdanmenyebabkanretensi sodium dancairanolehginjal. Hal inimenyebabkanpembuluhdarahmengendur, membiarkandarahmengalirlebihbebasdanberadapadatekanan yang lebihrendah, danmeningkatkankemampuanjantungmemompadarahdalambeberapajenisgagaljantung.


IndikasiIndikasi:Untukmengobatitekanandarahtinggi (hipertensi) danuntukmencegahseranganjantungpada orang denganpenyakitarteri coroner.EfekSamping:

  • EfekCV (hipotensi, angioedema)
  • EfekCNS (kelelahan, sakitkepala)
  • Efek GI (gangguanperasa)
  • Efekberturut-turut (batuktidakberdahak; upper resp tract symptoms)
  • EfekDermatologis (ruam, erythema multiforme, toxic epidermal necrolysis); reaksihipersensitivitas
  • Efekginjal (kerusakanginjal)
  • Gangguan electrolyte (hiperkalemia, hiponatremia,)
  • Gangguandarah.


  • Pasiendengan HF danmereka yang kekurangangulaatau air (melakukan diuretic atau dialysis) mungkinmengalamihipotensiselamatahapanpemberiandosisdalamterapi ACE inhibitor. (Mulaipengobatanataspengawasanmedis; padapasieninigunakandosisrendahdanlakukandenganposisiterlentang).
  • Hindaripadapasiendengan aortic stenosis atau outflow tract obstruction danharusterhindardaripenyakit actual renovascular.
  • Gunakandenganhati-hatipadapasiendenganriwayatketurunanatauidiophaticangioedema.
  • Fungsiginjalharusdiukursebelumpemberian ACE inhibitor danharusdiawasiselamaterapi. (Pasiendenganpenyakitginjalatau yang menggunakandosistinggiharusdiawasisecarareguleruntukmencegah proteinuria).


  • Pemberiandosismelaluimulut (per oral) 4 mg sehari 1 kali, selama 2 minggu, kemudianbolehtingkatkandosiskedosislanjutan.
  • Dosislanjutanmelaluimulut (per oral) 10 mg seharisatu kali.
2 6 benazepril lotensin
2.6 Benazepril (Lotensin)

Benazepriladalahangiotensin-converting enzyme (ACE) inhibitor yang bekerjadengancaramengurangizatkimia yang menyempitkanpembuluhdarah. Hal inimenyebabkanpembuluhdarahmelonggarsehinggamengurangitekanandarah.

  • EfekSamping:
  • EfekCV (hipotensi, angioedema)
  • Efek CNS (kelelahan, sakitkepala)
  • Efek GI (gangguanperasa)
  • Efeklainnya (batukkering,upper resp tract symptomps)
  • Efekdermatologis (ruamkulit, erythemamultiforme, toxic epidermal necrolysis)
  • Reaksihipersensitif; efekginjal (kerusakanginjal)
  • gangguan electrolyte (hyperkalemia,hyponatremia)
  • gangguandarah.


Pasiendengan HF danmereka yang kekurangangaramatau air (mengalamidiuretikataudialisis) mungkinmengalamihipotensiselamatingkatanawalterapiACE inhibitor

Mulaidengandosisrendahdantingkatkandosissecarabertahapjikadosis yang lebihrendahtersebutsudahdapatditerima.

  • Hindaripadapasiendengan aortic stenosisatauoutflow tract obstructiondanbiasanyaharusdihindaripadapasien yang didugamemilikipenyakitrenovaskuleraktual (actual renovascular disease).
  • Tidakbolehdiberikanpadapasienjikapasientersebutpernahmengalamiefeksamping yang mengancamnyawa (angioedema ataugagalginjal) selamapemberianobatsebelumnya, pasienhipotensif yang beradapadarisikosedangdarisyokkardiogenik.
  • Gunakandenganhati-hatipadapasien yang memilikiriwayatketurunanatauidiophatic angioedema.
  • Periksatekanandarah (BP), fungsiginjaldanelektrolit 1-2 minggusetelahpenambahantiapdosis, padawaktu 3 bulankemudianlakukansetiap 6 bulan. (Diperlukanlebihbanyakpengawsaanpadapasien yang pernahatau yang barumengalamidisfungsiginjal)
  • NSAIDs harusdihindarikarenahaltersebutbisamenutupmanfaatdanmeningkatkanefeksampingdari ACE inhibitor danmungkinsecarasinergismembahayakanfungsiginjal.
3 fosfonat yang mengandung agen
3. Fosfonat yang mengandung agen
  • Fosinopril (Monopril)

Fosinopriladalahgrupobat yang disebut angiotensin-converting enzyme (ACE) inhibitor yang digunakanuntukmengobatitekanandarahtinggi (hipertensi) ataugagaljantung.


IndikasiUntukmengobatitekanandarahtinggi (hipertensi) ataugagaljantung.EfekSamping:

  • EfekCV (hipotensi, angioedema)
  • Efek CNS (kelelahan, sakitkepala)
  • EfekGI (gangguanperasa)
  • Efeklainnya (batukkering; upper resp tract symptomps)
  • Efekdermatologis (ruamkulit, erythemamultiforme, toxic epidermal necrolysis)
  • Reaksihipersensitif; efekginjal (kerusakanginjal)
  • gangguanelectrolyte (hyperkalemia, hyponatremia)
  • gangguandarah.


  • Pasiendengan HF danmereka yang kekurangangaramatau air (mengalamidiuretikataudialisis) mungkinmengalamihipotensiselamatingkatanawalterapi ACE inhibitor. (Mulaipengobatanhanyadalampengawasanahli; padapasieninigunakandosisrendahdanpastikanpasiendalamposisiterlentang).
  • Mulaidengandosisrendahdantingkatkandosissecarabertahapjikadosis yang lebihrendahtersebutsudahdapatditerima.
  • Hindaripadapasiendengan aortic stenosis atau outflow tract obstruction danbiasanyaharusdihindaripadapasien yang didugamemilikipenyakitrenovaskuleraktual (actual renovascular disease).

4. Tidakbolehdiberikanpadapasienjikapasientersebutpernahmengalamiefeksamping yang mengancamnyawa (angioedema ataugagalginjal) selamapemberianobatsebelumnya, pasienhipotensif yang beradapadarisikosedangdarisyokkardiogenik.

5. Gunakandenganhati-hatipadapasien yang memilikiriwayatketurunanatauidiophaticangioedema.

6. Periksatekanandarah (BP), fungsiginjaldanelektrolit 1-2 minggusetelahpenambahantiapdosis, padawaktu 3 bulankemudianlakukansetiap 6 bulan. (Diperlukanlebihbanyakpengawsaanpadapasien yang pernahatau yang barumengalamidisfungsiginjal).

7. NSAIDs harusdihindarikarenahaltersebutbisamenutupmanfaatdanmeningkatkanefeksampingdari ACE inhibitor danmungkinsecarasinergismembahayakanfungsiginjal.


Dosis1. Dosisawal:

10 mg melaluimulut (per oral), 1 kali sehari.2. Sesuaikandosissecarabertahapberdasarkanreaksi yang muncul.3. Dosismaksimum:

40 mg/hari.