1.21k likes | 1.35k Views
Spectra correspond to entries in “protein identification file.xls”. MS/MS Fragmentation of YYDDNYIDGLFEIMRK Found in Q5UR95 , YL577_MIMIV Uncharacterized protein L577 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L577 PE=4 SV=1
E N D
Spectra correspond to entries in “protein identification file.xls”
MS/MS Fragmentation of YYDDNYIDGLFEIMRKFound in Q5UR95, YL577_MIMIV Uncharacterized protein L577 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L577 PE=4 SV=1 Match to Query 5087: 2299.094248 from(1150.554400,2+)Title: C:\Andrew Weston\TEMP\2_4067.pkl (query 461)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\166 Untitled\mascot_daemon_merge.mgf
MS/MS Fragmentation of YTGTQDNGGVHTNSGIINKFound in P23384, NPRE_BACCL Bacillolysin OS=Bacillus caldolyticus GN=npr PE=1 SV=1 Match to Query 5069: 2288.177448 from(1145.096000,2+)Title: C:\Andrew Weston\TEMP\2_4062.pkl (query 317)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\166 Untitled\mascot_daemon_merge.mgf
MS/MS Fragmentation of YTGSQDNGGVHTNSGINNKFound in P43263, NPRE_BREBE Bacillolysin OS=Brevibacillus brevis GN=npr PE=1 SV=1 Match to Query 3726: 2273.106072 from(758.709300,3+)Title: C:\Andrew Weston\TEMP\2_4028.pkl (query 159)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\156 Untitled\mascot_daemon_merge.mgf
MS/MS Fragmentation of YQTLLAEQGAAPVETQHRGKFound in Q7NNH7, RS6_GLOVI 30S ribosomal protein S6 OS=Gloeobacter violaceus GN=rpsF PE=3 SV=1 Match to Query 4349: 2549.352448 from(1275.683500,2+)Title: C:\Andrew Weston\TEMP\2_4042.pkl (query 61)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf
MS/MS Fragmentation of WDNEEYWQQAEGKFound in P42852, CUPP_BOMMO Pupal cuticle protein OS=Bombyx mori GN=PCP PE=2 SV=1 Match to Query 3195: 2033.934972 from(678.985600,3+)Title: C:\Andrew Weston\TEMP\2_4037.pkl (query 249)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\156 Untitled\mascot_daemon_merge.mgf
MS/MS Fragmentation of VSTLDMQNLPLTDKFound in Q3IGU4, SYN_PSEHT Asparaginyl-tRNA synthetase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=asnS PE=3 SV=1 Match to Query 4425: 2005.129248 from(1003.571900,2+)Title: C:\Andrew Weston\TEMP\2_4069.pkl (query 359)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\166 Untitled\mascot_daemon_merge.mgf
MS/MS Fragmentation of VSQKSLGAVIEDIQKFound in Q73IC3, ENGB_WOLPM Probable GTP-binding protein engB OS=Wolbachia pipientis wMel GN=engB PE=3 SV=1 Match to Query 3843: 2273.037072 from(758.686300,3+)Title: C:\Andrew Weston\TEMP\2_4050.pkl (query 259)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf
MS/MS Fragmentation of VQSISLGQGQGPIAEKMVKFound in Q9C0G6, DYH6_HUMAN Dynein heavy chain 6, axonemal OS=Homo sapiens GN=DNAH6 PE=1 SV=3 Match to Query 4406: 2606.289372 from(869.770400,3+)Title: C:\Andrew Weston\TEMP\2_4041.pkl (query 89)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf
MS/MS Fragmentation of VAFQAVTKAGQYAYRFound in B6EN31, RL20_ALISL 50S ribosomal protein L20 OS=Aliivibrio salmonicida (strain LFI1238) GN=rplT PE=3 SV=1 Match to Query 4196: 1901.056872 from(634.692900,3+)Title: C:\Andrew Weston\TEMP\2_4062.pkl (query 302)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\166 Untitled\mascot_daemon_merge.mgf
MS/MS Fragmentation of VAFQAVTKAGQYAYRFound in B6EN31, RL20_ALISL 50S ribosomal protein L20 OS=Aliivibrio salmonicida (strain LFI1238) GN=rplT PE=3 SV=1 Match to Query 4198: 1901.089272 from(634.703700,3+)Title: C:\Andrew Weston\TEMP\2_4061.pkl (query 125)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\166 Untitled\mascot_daemon_merge.mgf
MS/MS Fragmentation of TSALLTCAKDSQFSASYFEAAFFPRFound in Q08844, YO365_YEAST Uncharacterized membrane protein YOR365C OS=Saccharomyces cerevisiae GN=YOR365C PE=1 SV=1 Match to Query 4811: 3267.614896 from(817.911000,4+)Title: C:\Andrew Weston\TEMP\2_4051.pkl (query 166)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf
MS/MS Fragmentation of TQLYNFKKFound in P40086, COX15_YEAST Cytochrome c oxidase assembly protein COX15 OS=Saccharomyces cerevisiae GN=COX15 PE=1 SV=1 Match to Query 2289: 1542.744672 from(515.255500,3+)Title: C:\Andrew Weston\TEMP\2_4048.pkl (query 237)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf
MS/MS Fragmentation of TPLIISGGSSSRINLYKFound in Q6F260, SECA_MESFL Protein translocase subunit secA OS=Mesoplasma florum GN=secA PE=3 SV=1 Match to Query 3741: 2273.277448 from(1137.646000,2+)Title: C:\Andrew Weston\TEMP\2_4031.pkl (query 351)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\156 Untitled\mascot_daemon_merge.mgf
MS/MS Fragmentation of TNISHNGTYHCSGMGKHRFound in P12314, FCGR1_HUMAN High affinity immunoglobulin gamma Fc receptor I OS=Homo sapiens GN=FCGR1A PE=1 SV=2 Match to Query 4399: 2606.171048 from(1304.092800,2+)Title: C:\Andrew Weston\TEMP\2_4055.pkl (query 346)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf
MS/MS Fragmentation of TLSFGSDLNYSTKFound in Q6PCR7, EIF3A_DANRE Eukaryotic translation initiation factor 3 subunit A OS=Danio rerio GN=eif3a PE=2 SV=1 Match to Query 3127: 1943.017296 from(486.761600,4+)Title: C:\Andrew Weston\TEMP\2_4051.pkl (query 133)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf
MS/MS Fragmentation of TKASIPNVAPVNINGGGGSRFound in P97528, CNTN6_RAT Contactin-6 OS=Rattus norvegicus GN=Cntn6 PE=1 SV=1 Match to Query 3661: 2219.011448 from(1110.513000,2+)Title: C:\Andrew Weston\TEMP\2_4047.pkl (query 196)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf
MS/MS Fragmentation of TIPECQELLPKFound in P51044, CISY_ASPNG Citrate synthase, mitochondrial OS=Aspergillus niger GN=cit-1 PE=2 SV=1 Match to Query 2282: 1540.912572 from(514.644800,3+)Title: C:\Andrew Weston\TEMP\2_4046.pkl (query 155)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf
MS/MS Fragmentation of TGTSVSLGKFound in Q9FDN7, FPRA_MOOTA Nitric oxide reductase OS=Moorella thermoacetica (strain ATCC 39073) GN=fprA PE=1 SV=1 Match to Query 950: 1076.634048 from(539.324300,2+)Title: C:\Andrew Weston\TEMP\2_4060.pkl (query 73)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\166 Untitled\mascot_daemon_merge.mgf
MS/MS Fragmentation of SYTINSNSLLLNSTLQKFound in P35194, UTP20_YEAST U3 small nucleolar RNA-associated protein 20 OS=Saccharomyces cerevisiae GN=UTP20 PE=1 SV=3 Match to Query 3621: 2249.793248 from(1125.903900,2+)Title: C:\Andrew Weston\TEMP\2_4030.pkl (query 86)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\156 Untitled\mascot_daemon_merge.mgf
MS/MS Fragmentation of SVNLNNNKFound in Q55BF4, UCPA_DICDI Mitochondrial substrate carrier family protein ucpA OS=Dictyostelium discoideum GN=ucpA PE=3 SV=1 Match to Query 919: 1173.590848 from(587.802700,2+)Title: C:\Andrew Weston\TEMP\2_4049.pkl (query 65)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf
MS/MS Fragmentation of SVKINLPHFTLIGATTRFound in A8EZ44, RUVB_RICCK Holliday junction ATP-dependent DNA helicase ruvB OS=Rickettsia canadensis (strain McKiel) GN=ruvB PE=3 SV=1 Match to Query 3662: 2219.021848 from(1110.518200,2+)Title: C:\Andrew Weston\TEMP\2_4054.pkl (query 315)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf
MS/MS Fragmentation of SVKINLPHFTLIGATTRFound in A8EZ44, RUVB_RICCK Holliday junction ATP-dependent DNA helicase ruvB OS=Rickettsia canadensis (strain McKiel) GN=ruvB PE=3 SV=1 Match to Query 4850: 2219.028848 from(1110.521700,2+)Title: C:\Andrew Weston\TEMP\2_4069.pkl (query 571)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\166 Untitled\mascot_daemon_merge.mgf
MS/MS Fragmentation of STQGTTKFound in P32330, YKM1_YEAST WD repeat-containing protein YKL121W OS=Saccharomyces cerevisiae GN=YKL121W PE=1 SV=1 Match to Query 609: 991.519448 from(496.767000,2+)Title: C:\Andrew Weston\TEMP\2_4070.pkl (query 28)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\166 Untitled\mascot_daemon_merge.mgf
MS/MS Fragmentation of SSCPLANSQYATIKFound in Q1RML7, MAK16_BOVIN Protein MAK16 homolog OS=Bos taurus GN=MAK16 PE=2 SV=1 Match to Query 2671: 1710.754448 from(856.384500,2+)Title: C:\Andrew Weston\TEMP\2_4050.pkl (query 211)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf
MS/MS Fragmentation of SRQGKGNLGSLQLEVRLRFound in Q6PFQ7, RASL2_MOUSE Ras GTPase-activating protein 4 OS=Mus musculus GN=Rasa4 PE=2 SV=1 Match to Query 3910: 2284.198096 from(572.056800,4+)Title: C:\Andrew Weston\TEMP\2_4049.pkl (query 167)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf
MS/MS Fragmentation of SLLSNRTKFound in P27754, RT03_OENBE Ribosomal protein S3, mitochondrial OS=Oenothera bertiana GN=RPS3 PE=3 SV=2 Match to Query 1196: 1228.504048 from(615.259300,2+)Title: C:\Andrew Weston\TEMP\2_4045.pkl (query 9)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf
MS/MS Fragmentation of SLDLLAQARRMAPGLNTKFound in B5EAX0, LIPA_GEOBB Lipoyl synthase OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=lipA PE=3 SV=1 Match to Query 3981: 2307.289272 from(770.103700,3+)Title: C:\Andrew Weston\TEMP\2_4049.pkl (query 146)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf
MS/MS Fragmentation of SLDLLAQARRMAPGLNTKFound in B5EAX0, LIPA_GEOBB Lipoyl synthase OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=lipA PE=3 SV=1 Match to Query 3986: 2307.480672 from(770.167500,3+)Title: C:\Andrew Weston\TEMP\2_4051.pkl (query 397)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf
MS/MS Fragmentation of SLAIDPSGTWLATGGDDGTVRVWELLTGKFound in A6RRD4, ERB1_BOTFB Ribosome biogenesis protein erb1 OS=Botryotinia fuckeliana (strain B05.10) GN=erb1 PE=3 SV=1 Match to Query 4815: 3324.552096 from(832.145300,4+)Title: C:\Andrew Weston\TEMP\2_4041.pkl (query 70)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf
MS/MS Fragmentation of SKLVPSSSEINVASRFound in P42842, YN53_YEAST Uncharacterized protein YNL313C OS=Saccharomyces cerevisiae GN=YNL313C PE=1 SV=1 Match to Query 3242: 2084.258248 from(1043.136400,2+)Title: C:\Andrew Weston\TEMP\2_4033.pkl (query 167)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\156 Untitled\mascot_daemon_merge.mgf
MS/MS Fragmentation of SILSGMKFound in Q8PS92, DTDA_METMA D-tyrosyl-tRNA(Tyr) deacylase OS=Methanosarcina mazei GN=dtdA PE=3 SV=1 Match to Query 822: 1044.551848 from(523.283200,2+)Title: C:\Andrew Weston\TEMP\2_4060.pkl (query 29)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\166 Untitled\mascot_daemon_merge.mgf
MS/MS Fragmentation of SGNIEDIEVENLINYIKFound in A8GN90, SYP_RICAH Prolyl-tRNA synthetase OS=Rickettsia akari (strain Hartford) GN=proS PE=3 SV=1 Match to Query 4972: 2272.089672 from(758.370500,3+)Title: C:\Andrew Weston\TEMP\2_4072.pkl (query 201)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\166 Untitled\mascot_daemon_merge.mgf
MS/MS Fragmentation of SCQPNVELVTIKFound in P36124, SET3_YEAST SET domain-containing protein 3 OS=Saccharomyces cerevisiae GN=SET3 PE=1 SV=1 Match to Query 2583: 1682.900848 from(842.457700,2+)Title: C:\Andrew Weston\TEMP\2_4050.pkl (query 330)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf
MS/MS Fragmentation of SANNLIEALKFound in Q3AUH7, DNLJ_SYNS9 DNA ligase OS=Synechococcus sp. (strain CC9902) GN=ligA PE=3 SV=1 Match to Query 1669: 1342.657248 from(672.335900,2+)Title: C:\Andrew Weston\TEMP\2_4055.pkl (query 314)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf
MS/MS Fragmentation of RYPGQTEQEMILEVCGSGFLKQMVRFound in C6BW69, TRUA_DESAD tRNA pseudouridine synthase A OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=truA PE=3 SV=1 Match to Query 4465: 3210.401172 from(1071.141000,3+)Title: C:\Andrew Weston\TEMP\2_4027.pkl (query 48)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\156 Untitled\mascot_daemon_merge.mgf
MS/MS Fragmentation of RYPGQTEQEMILEVCGSGFLKQMVRFound in C6BW69, TRUA_DESAD tRNA pseudouridine synthase A OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=truA PE=3 SV=1 Match to Query 5956: 3210.598572 from(1071.206800,3+)Title: C:\Andrew Weston\TEMP\2_4060.pkl (query 167)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\166 Untitled\mascot_daemon_merge.mgf
MS/MS Fragmentation of RQQVMPPTEQSKRPRFound in Q8CHI8, EP400_MOUSE E1A-binding protein p400 OS=Mus musculus GN=Ep400 PE=1 SV=2 Match to Query 3568: 2188.031848 from(1095.023200,2+)Title: C:\Andrew Weston\TEMP\2_4054.pkl (query 343)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf
MS/MS Fragmentation of RNVVKSMQGADLTQRFound in P54122, RNJ_CORGL Ribonuclease J OS=Corynebacterium glutamicum GN=Cgl1970 PE=3 SV=2 Match to Query 3146: 1948.959248 from(975.486900,2+)Title: C:\Andrew Weston\TEMP\2_4054.pkl (query 404)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf
MS/MS Fragmentation of RMLLSTCKNFLSLQSCVYYEDIYYYEEIHKFound in Q5UR85, YR636_MIMIV Putative FNIP repeat-containing protein R636 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R636 PE=4 SV=1 Match to Query 4590: 4684.895296 from(1172.231100,4+)Title: C:\Andrew Weston\TEMP\2_4038.pkl (query 395)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\156 Untitled\mascot_daemon_merge.mgf
MS/MS Fragmentation of RCSVSVCGKFound in Q6P2L6, NSD3_MOUSE Histone-lysine N-methyltransferase NSD3 OS=Mus musculus GN=Whsc1l1 PE=1 SV=2 Match to Query 806: 1167.541248 from(584.777900,2+)Title: C:\Andrew Weston\TEMP\2_4040.pkl (query 288)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\156 Untitled\mascot_daemon_merge.mgf
MS/MS Fragmentation of RASQGLISAVENSESDSSEAKEEVSRFound in Q6PR54, RIF1_MOUSE Telomere-associated protein RIF1 OS=Mus musculus GN=Rif1 PE=1 SV=2 Match to Query 4729: 3153.511272 from(1052.177700,3+)Title: C:\Andrew Weston\TEMP\2_4051.pkl (query 535)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf
MS/MS Fragmentation of QYVNVVEYLIRKFound in Q9J4Z9, V241_FOWPV Putative ankyrin repeat protein FPV241 OS=Fowlpox virus GN=FPV241 PE=4 SV=1 Match to Query 2943: 1831.803372 from(611.608400,3+)Title: C:\Andrew Weston\TEMP\2_4057.pkl (query 136)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf
MS/MS Fragmentation of QYGLSYVKFound in A7I2F2, SUCC_CAMHC Succinyl-CoA ligase [ADP-forming] subunit beta OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=sucC PE=3 SV=1 Match to Query 1301: 1264.685448 from(633.350000,2+)Title: C:\Andrew Weston\TEMP\2_4037.pkl (query 80)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\156 Untitled\mascot_daemon_merge.mgf
MS/MS Fragmentation of QVMEEAGKFound in Q90871, IRF8_CHICK Interferon regulatory factor 8 OS=Gallus gallus GN=IRF8 PE=2 SV=1 Match to Query 766: 1134.563848 from(568.289200,2+)Title: C:\Andrew Weston\TEMP\2_4049.pkl (query 15)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf
MS/MS Fragmentation of QVLKTVDVPTGSSVRFound in Q4ZNP2, RNFH_PSEU2 Protein rnfH OS=Pseudomonas syringae pv. syringae (strain B728a) GN=rnfH PE=3 SV=1 Match to Query 2981: 1894.035672 from(632.352500,3+)Title: C:\Andrew Weston\TEMP\2_4035.pkl (query 478)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\156 Untitled\mascot_daemon_merge.mgf
MS/MS Fragmentation of QTGGLTRAMDRGCKFound in Q751N2, ATM1_ASHGO Iron-sulfur clusters transporter ATM1, mitochondrial OS=Ashbya gossypii GN=ATM1 PE=3 SV=1 Match to Query 3978: 1777.831848 from(889.923200,2+)Title: C:\Andrew Weston\TEMP\2_4062.pkl (query 147)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\166 Untitled\mascot_daemon_merge.mgf
MS/MS Fragmentation of QTFVRMLTCRKFound in Q646A3, TA2R8_GORGO Taste receptor type 2 member 8 OS=Gorilla gorilla gorilla GN=TAS2R8 PE=3 SV=1 Match to Query 2754: 1764.757448 from(883.386000,2+)Title: C:\Andrew Weston\TEMP\2_4036.pkl (query 356)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\156 Untitled\mascot_daemon_merge.mgf
MS/MS Fragmentation of QTEAENNTLKFound in Q6NY15, TSG10_MOUSE Testis-specific gene 10 protein OS=Mus musculus GN=Tsga10 PE=1 SV=1 Match to Query 2011: 1457.727648 from(729.871100,2+)Title: C:\Andrew Weston\TEMP\2_4056.pkl (query 142)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf
MS/MS Fragmentation of QSLQAVLPEISGNKTSPLRFound in A7ZVM4, IRAD_ECO24 Anti-adapter protein iraD OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=iraD PE=3 SV=2 Match to Query 4348: 2549.341272 from(850.787700,3+)Title: C:\Andrew Weston\TEMP\2_4051.pkl (query 369)Data file C:\Program Files\Matrix Science\Mascot Daemon\mgf\161 Untitled\mascot_daemon_merge.mgf