Download
administrasi publik dan administrasi bisnis n.
Skip this Video
Loading SlideShow in 5 Seconds..
ADMINISTRASI PUBLIK DAN ADMINISTRASI BISNIS PowerPoint Presentation
Download Presentation
ADMINISTRASI PUBLIK DAN ADMINISTRASI BISNIS

ADMINISTRASI PUBLIK DAN ADMINISTRASI BISNIS

576 Views Download Presentation
Download Presentation

ADMINISTRASI PUBLIK DAN ADMINISTRASI BISNIS

- - - - - - - - - - - - - - - - - - - - - - - - - - - E N D - - - - - - - - - - - - - - - - - - - - - - - - - - -
Presentation Transcript

  1. ADMINISTRASI PUBLIK DAN ADMINISTRASI BISNIS Sebagaiilmutidakadabedaprinsip, rumusdandalilantaraadm. Publikdan Adm. Bisniskarenasifatuniversalitasprinsip, rumusdandaliltersebut. Tetapi, dalampenerapandanperwujudannya (aspektehnis) terdapatperbedaanyaitumeliputi :

  2. 1. FAKTOR TUJUAN ADM. PUBLIK ADM. BISNIS Meningkatkankemakmuranseluruhrakyatterlepasdarisistempolitikdanekonomi yang dianut , semuanegara modern menyatakanbahwanegaratersebutadalah “Welfare State” Mengusahakankeabadiankelangsunganhiduporganisasimelaluiakumulasi modal, penambahaninvestasi, diversifikasiprodukdanlaba yang wajar

  3. 2. FAKTOR MOTIF ADM. PUBLIK ADM. BISNIS Pemberian service yang efektif, efesiendanekonomiskarenatujuan yang hendakdicapaisuatunegaratidakterbatas, alatpemuasnyaterbatas. Jadiharusdigunakansumberdayaseminimalmungkinukmenghasilkan output sebesarmungkin MencariLaba yang wajar : • Dapatmemuaskankebutuhanpelanggannya. • Memberidevidenkepadapemilik modal • Memungkinkan re investasiukperluasanusaha • Menjaminkelangsunganhidupusaha

  4. 3. SIFAT PELAYANAN ADM. PUBLIK ADM. BISNIS Melayanisemuawarganegara dg perlakuan yang samakarenakewarganegaraanberkedudukansamadihadapanhukum. Aparatur Negara adalahabdiseluruhrakyat Membedakansifatpelayanankarena motif laba, sehinggapelayanandidasariolehtingkatdayabelilangganan. Meskipunpelangganadalah raja tetapipastiada raja besardan raja kecil

  5. 4. WILAYAH YURISDIKSI ADM. PUBLIK ADM. BISNIS Adm. Publiksamadenganwilayahkekuasaannegara. Adm. Bisnistidakmempunyaikekuasaan, tetapihanyawilayahoperasi yang luasnyabisasama, lebihkecilataulebihluasdariwilayahkekuasaannegara

  6. 5. KEKUASAAN ADM. PUBLIK ADM. BISNIS Kekuasaanadm. Publikmemperolehnyadarilembagaperwakilanrakyatkarenadalamnegarademokrasi, rakyatlah yang pemilikdansumberdarisemuakekuasaan Terletakpadabesarnya modal, skill tehnisdanmanajerial yang dimilikisertakemampuanmemamfaatkantehnologiterlebihdahuludarikompetitor

  7. 6. ORIENTASI POLITIK ADM. PUBLIK ADM. BISNIS Adm. Publiksebagaiabdirakyatnetraldalamorientasipolitik, berdiridiatassemuagolongan, alirandanlapisanmasyarakat. Adm. Bisnismemihakdanidentikdenganorientasipolitikpemilik modal

  8. 7. CARA BEKERJA ADM. PUBLIK ADM. BISNIS Adm. Publikumumnyalambankarenamenggunakanpendekatanlegalitasdalamsetiapkegiatannya. Adm. Bisnismenggunakanpendekatan program daripadalegalitaskarenamenghadapikompetisisehinggaperlusifatinovatifuntukmenghadapikompetisibaikdomestik, regional maupuninternasional

  9. Pelayananadm. publik Pelayananadm. bisnis Video Video

  10. ADMINISTRASI DAN MANAJEMEN ILMIAH DAN NON ILMIAH Administrasidanmanajemendapatdianalisisdalamduasegi : • SebagaiSeni → Fenomenasosialtelahadasejaktimbulnyaperadapanmanusia (zamanpurba) sehinggatimbullahgerakanManajemenIlmiahdikajitidakberdasarkankeilmuan (non ilmiah). • SebagaiIlmu → Yang bersifatkeilmuansejak 1886 hinggasekarang

  11. FILSAFAT YANG DIANUT Adm. Dan manajemenilmiah Adm. Dan manajemen non ilmiah PEOPLE ORIENTED Memandangmanusiasbgoknumygberkepribadian, bertujuandanbercita-citasertapunyarasio. Bukanalatsemata. Manusiapunyarasiomakadptmenjadipendorongefesiensijkmanusiadipandang & diperlukansbgmanusia JOB CENTRED Dalamusahauntukmencapaitujuanygpentingadalah tugas2 ygdilaksanakanharusselesaitepatpadawaktunya

  12. PENDEKATAN YANG DIPERGUNAKAN Adm. Dan manajemenilmiah Adm. Dan manajemen non ilmiah EFFECIENCY AND ECONOMY Semakindisadaribahwa sumber2 ygtersediamakinterbatas, sehinggaperluefesiendanekonomisantara lain dg memperkecil input ukmenghasilkan output yglebihbesar, menghindaripemborosan, duplikasidanketidakserasiankerja EFFEKTIVITAS Yang pentingtujuantercapai, tidakpedulipengorbanan yang diberikan

  13. METODE KERJA Adm. Dan manajemenilmiah Adm. Dan manajemen non ilmiah SISTIMATIS Sistemdanprosedurkerjaygsesuai dg kebutuhan, prosespengambilankeputusan, prosespengambilankeputusanygdidasarkanatas data yg up to date, lengkapdandptdipercaya, “the right man in the right place”, strukturygsesuaidansalurankomunikasiygefektif TIDAK SISTIMATIS Didasarkan trial dan error sehinggaseringsalah, keliru, salahperhitungandanpemborosan.

  14. CARA BEKERJA Adm. Dan manajemenilmiah Adm. Dan manajemen non ilmiah Cepatdantepat Mengikutitradisiygtelahdijalankan, kurangdayaciptadancenderunglamban