130 likes | 161 Views
Explore the role of Hox genes and homeodomain proteins in directing the A-P axis in vertebrates. Understand how inductive interactions shape early embryo development. Discover the mechanisms behind the modular construction of plants and the impact of domestication on maize and fish.
E N D
Homeodomain protein • A homeobox is about 180 base pairs long and encodes a protein domain that binds DNA with the nucleotide sequence TAAT.. • RRRKRTA-YTRYQLLE-LEKEFLF NRYLTRRRRIELAHSL-NLTERHIKIWFQNRRMKWKKEN
The size of the meristem is controlled by a self-regulating balance between a short-range stimulatory signal produced by cells expressing Wuschel(yellow arrow), and a longer-range inhibitory signal delivered by Clavata3 (red bars).
A Hierarchy of Inductive Interactions Subdivides the Vertebrate Embryo
http://www.nature.com/nrm/journal/v7/n4/extref/nrm1855-s1.avihttp://www.nature.com/nrm/journal/v7/n4/extref/nrm1855-s1.avi