Paggawa ng Epektibong Powerpoint Presentation - PowerPoint PPT Presentation

paggawa ng epektibong powerpoint presentation n.
Download
Skip this Video
Loading SlideShow in 5 Seconds..
Paggawa ng Epektibong Powerpoint Presentation PowerPoint Presentation
Download Presentation
Paggawa ng Epektibong Powerpoint Presentation

play fullscreen
1 / 56
Paggawa ng Epektibong Powerpoint Presentation
196 Views
Download Presentation
perry
Download Presentation

Paggawa ng Epektibong Powerpoint Presentation

- - - - - - - - - - - - - - - - - - - - - - - - - - - E N D - - - - - - - - - - - - - - - - - - - - - - - - - - -
Presentation Transcript

  1. PaggawangEpektibongPowerpoint Presentation

  2. PaggawangEpektibongPowerpoint Presentation Clear Progressive Simple Consistent Summary Big

  3. Make It Big

  4. Make it Big (Text) • This is Arial 12 • This is Arial 18 • This is Arial 24 • This is Arial 32 • This is Arial 36 • This is Arial 44

  5. Make it Big (Text) Too Small • This is Arial 12 • This is Arial 18 • This is Arial 24 • This is Arial 32 • This is Arial 36 • This is Arial 44

  6. 2 m Make It Big (How to Estimate) • Look at it from 2 metres away

  7. Keep It Simple

  8. Keep It Simple (Text) • Too manycolours • TooManyFontsandStyles • The 6 x 7 rule • No more than 6 lines per slide • No more than 7 words per line

  9. Keep It Simple (Text) • Angmgaproblemangkinakaharapnatingmgakawani, REPS at mgagurong UP ay hindimahihiwalaysamasmalawaknaproblemangkinakaharapngmamamayang Pilipino. • Angmgasuliraninnatinsa UP, ngiba pang mgakawanisagobyerno, ngmgamanggagawasapribadongsektor at ngmgamagsasakahinggilsakabuhayan, satrabaho at karapatan ay maiuugatnatinsapangkalahatangsitwasyonnglipunan. Too detailed !

  10. Keep It Simple (Text) Angmgakinakaharap natingmgaproblema ay: • hindimahihiwalaysamgaproblemangmamamayangPilipino. • Maiuugatitosapangkalahatangsitwasyonngatinglipunan.

  11. SSL 3 Too detailed !

  12. EXECUTIVE CATEGORY 72% - 138% P27,527 - P50,122 PROFESSIONAL LEVEL 45% - 97% SUB-PROFESSIONAL LEVEL 30% - 46% P5,801 - P24,554 Much Simpler P2,851 - P5,229 Salary increase from 2008 to 2012 under SSL3

  13. Keep It Simple (Picture) • Art work may distract your audience • Artistry does not substitute for content

  14. Keep It Simple (Sound) • Sound effects may distract too • Use sound only when necessary

  15. Keep It Simple (Transition) • This transition is annoying, not enhancing • "Appear" and "Disappear" are better

  16. 2 m Keep It Simple (Animation) Simple & to the point

  17. WalangAsenso WalangPagbabago MasNaghihirap Lubogsautang SalatnaBenepisyo KawalanngOportunidad MababangSahod Hanap ay Trabaho

  18. Hanap ay Trabaho MababangSahod KawalanngOportunidad SalatnaBenepisyo Lubogsautang MasNaghihirap WalangPagbabago WalangAsenso

  19. Make It Clear

  20. Make It Clear (Capitalisation) • ALL CAPITAL LETTERS ARE DIFFICULT TO READ • Upper and lower case letters are easier

  21. Sanserif Z Serif Z Make It Clear (Fonts) clear busy • Serif fonts are difficult to read on screen • Sanserif fonts are clearer

  22. Make It Clear (Fonts) • Italics are difficult to read on screen • Italics are difficult to read on screen • Normal or bold fonts are clearer • Underlines may signify hyperlinks • Instead, use colours to emphasise

  23. Make It Clear (Numbers) Use numbers for lists with sequence For example: Paanoipaglalabanangkarapatan? 1. Malinawan 2. Kumilos 3. Magkaisa

  24. Make It Clear (Bullets) Use bullets to show a list without • Priority • Sequence • Hierarchy, …..

  25. MgaPatakaranngGobyernosaEkonomiya • Liberalization • (pagbubukasngekonomiyasa foreign trade at Investment) • Privatization • (pagbebentangmgapag-aaringgobyernosapribado) • Deregulation • (pag-aalisngkontrolnggobyernosamgaindustriya)

  26. Make It Clear (Colours) • Use contrasting colours • Light on dark vs dark on light • Use complementary colours

  27. low contrast high contrast Make It Clear (Contrast) • Use contrasting colours • Light on dark vs dark on light • Use complementary colours

  28. Make It Clear (Contrast) • Use contrasting colours • Light on dark vs dark on light • Use complementary colours This is light on dark

  29. Make It Clear (Contrast) • Use contrasting colours • Light on dark vs dark on light • Use complementary colours This is dark on light

  30. Make It Clear (Size) • Size implies importance

  31. MgaPangunahingSuliranin 2. AtrasadongEkonomyananakasandigsaagrikultura

  32. Make It Clear (Size) • Size implies importance

  33. Make It Clear (Focal Points) • Focal points direct attention

  34. Make It Clear (Focal Points) • Focal points direct attention

  35. LOANS Sa maskongkreto pang epektoangpribatisasyon, deregulasyon at liberalisasyon ay naglalamanngmgasumusunod: • Pagbabawasnggastusinnggobyernolalunasamgaserbisyongpanlipunan • Patuloyangawtomatikongpagbabayadngdayuhangpautang

  36. Be Progressive

  37. In 2006 COMBINED INCOME for the year of the poorest 10.4 million Filipino families. NET WORTH 20 richest Filipinos P801 billion ($15.6 billion) Too many in one go! Arroyo allies, Lucio Tan, Enrique Razon Jr., Eduardo Cojuangco Jr. and Enrique Aboitiz P77,000 per year/family P6,476 per month/family Salary Grade Step1-3 P 6,149 - P6,460 (2008 Before SSL3) Source: Forbes Asia , NSCB, PDI, 2009

  38. In 2006 COMBINED INCOME for the year of the poorest 10.4 million Filipino families. NET WORTH 20 richest Filipinos P801 billion ($15.6 billion) Progressive & thus focused Arroyo allies, LucioTan, Enrique Razon Jr., Eduardo Cojuangco Jr. and Enrique Aboitiz P77,000 per year/family P6,476 per month/family Salary Grade Step1-3 P 6,149 - P6,460 (2008 Before SSL3) Source: Forbes Asia , NSCB, PDI, 2009

  39. KAWANI SG 1 (PhP 9,000.00/buwan) hanggang SG 18 (PhP 31,351.00/buwan) REPS SG 12 (PhP 19,940.00/buwan) hanggang SG 26 (PhP 58,028.00 ) FACULTY SG 14 parasamga Instructor I (PhP 23,044.00) hanggang SG 29 Step 5 parasamga Full Professors (PhP 76,368.00/buwan) Too many & not focused National Wages and Productivity Commission The FLW is defined as the minimum amount needed for a family of six members to meet their daily food and non-food needs plus 10% allocation for savings. = P1,017 X 30 days P 30,510.00/buwan KITA PARA MABUHAY NG MARANGAL

  40. KAWANI SG 1 (PhP 9,000.00/buwan) hanggang SG 18 (PhP 31,351.00/buwan) REPS SG 12 (PhP 19,940.00/buwan) hanggang SG 26 (PhP 58,028.00 ) FACULTY SG 14 parasamga Instructor I (PhP 23,044.00) hanggang SG 29 Step 5 parasamga Full Professors (PhP 76,368.00/buwan) Progressive & thus focused National Wages and Productivity Commission The FLW is defined as the minimum amount needed for a family of six members to meet their daily food and non-food needs plus 10% allocation for savings. = P1,017 X 30 days P 30,510.00/buwan KITA PARA MABUHAY NG MARANGAL

  41. Be Consistent

  42. Be Consistent • Differences draw attention • Differences may imply importance • Use surprises to attract not distract

  43. This tick draws attention Be Consistent • Differences draw attention • Differences may imply importance • Use surprises to attract not distract

  44. These differences distract! Be Consistent • Differences draw attention • Differences may imply importance • Use surprises to attract not distract

  45. This implies importance Be Consistent • Differences draw attention • Differences may imply importance • Use surprises to attract not distract

  46. Confusing differences! Be Consistent • Differences draw attention • Differences may imply importance • Use surprises to attract not distract

  47. This surprise attracts Be Consistent • Differences draw attention • Differences may imply importance • Use surprises to attract not distract

  48. These distract! Be Consistent • Differences draw attention • Differences may imply importance • Use surprises to attract not distract

  49. In Summary • Big • Simple • Clear • Progressive • Consistent