slide1 n.
Skip this Video
Loading SlideShow in 5 Seconds..
Download Presentation


1089 Views Download Presentation
Download Presentation


- - - - - - - - - - - - - - - - - - - - - - - - - - - E N D - - - - - - - - - - - - - - - - - - - - - - - - - - -
Presentation Transcript


  2. Konsepmelalui percobaanbinatang Teori Stimulus Respon Dolard& Miller StrukturKepribadian Perkembangan kepribadian DinamikaKepribadian Perangkat innate & primary process ketidaksadaran Situasipembelajaran (training situation) Model konflik Kontekssosial Proses belajar motivasi Proses mental

  3. PERCOBAAN I TikusdidlmkotakdiberisuaraBel Tikusmerespontptdkbergerak Merasakesakitan, tikusberusahamelompatipagar Tikusdiberisuara + sengatlistrik Tikusmelompatipagar Suaradanlistrikdihentikan Prosesdiulangiberulangkali Respontikussemakincepat Hanyadiberisuara Tikusmeloncat Suara Pagar Kejutlistrik

  4. PERCOBAAN 2 Tikuspunyarespondaripercobaan 1  mendengarsuarabel = meloncatpagar Penelitimengenalkanpadasituasibaru # Beldibunyikandantikusmulaimeloncatipagar. Saattikusberhasil loncat, beltetapbersuara. # Krnbeltetapbersuara, makatikustetapmeloncat-loncathinggaia menekantuas. # Saattuasditekan, makasuara berhenti Responmeloncatpagartidakdilakukanlagidandigantidenganresponmenekantuas Suara Pagar Tuas

  5. Kejutlistrik (US) dipasangkandenganbel (CS) menimbulkanrespon internal (remot) dalamhalinirasa sakit. Eksperimen yang dilakukanberkali-kali mengakibatkanrasa sakit (remot) yang berulang pula sehinggapadaakhirnyarasa sakit (remot) itumenjadistimulus drive (SD) untukmemunculkansuatuperilaku (Remot), yaitumenyeberangipagar. Prosesperubahan(remot) menjadi(SD) disebutsebagaiinternal emotional sequence. Keinginanuntukmenghilangkanrasa sakit (remot) menjadidorongan (SD) untukmemunculkanrespontertentu (Remot) sehingga rasa sakitituhilang

  6. remot US (KejutListrik) SD (drive) R emot Internal emotional sequence Habit CS (suara) # HABIT = ASOSIASI YANG DIPELAJARI Tikusmelompatipagarkarenadiberilistrik = primary drive Tikusmelompatpagarkarenamendengarsuarabel = secondary drive

  7. Primary Drive Secondary Drive

  8. StrukturKepribadian • Strukturkepribadiansebagianbesardibentukoleh habit, (hubungan S-R). • Kepribadianterdiridari habit-habit • Habit dapatberupaperilaku yang overt ataupun yang covert • Bentuk habit terbentuksesuai dg peristiwaygdialami • Habit bisadigantikan dg habit baruakibatpengalamandikemudianhari

  9. DinamikaKepribadian • Motivasi (Drives) • Prosesbelajar • Prosesmental yglebihtinggi • Model konflik • ketidaksadaran

  10. 1. Motivasi (Drives) # Masing-masingindividumengembangkan drive sekunder yang tugasnyauntuk memunculkantingkahlaku. # Namunpadamasyarakat modern, dorongan drive skundernampakbanyakyg menggantikanperan drive primer. Drive sekundertsbseperti, kecemasan, rasa malu, keinginanmenyenangkanorang lain Dalamkehidupanmanusia, drive ygmenggerakkanperilakubukansajakrn reward primer akantetapiperistiwa-peristiwaygmulanyanetral, namun seringterpasangkan dg reward primer. Contoh : 1. Senyumanibumerupakan reward sekunderbagibayi, krndiasosiasikan dg Pemberianmakandanbentukpemeliharaan lain ygmendatangkankenikmatandan menjauhkandariketidaknyamanan. 2. Uangdiasosiasikanolehorang-orang dg kebutuhansandang, pangan, papan.

  11. Reward Sekunder Reward Primer

  12. 2. The learning process… Padaprosesbelajar, individuharuswant something, notice something, do something, get something. • Drive adalah stimulus yang cukupkuatuntukmengaktivasisuatuperilakunamuntidakmenentukanbentukperilaku yang akandimunculkan. Secondary drive biasanyauntukmemenuhi primary drive. Seseorangygtakutpresentasimengasosiasikanbahwa audience memberinya rasa tidaknyaman/ rasa sakit. • Cue adalah stimulus yang menentukansecaratepatrespon yang akanditampilkan. Ex : responthdsuarakeras, responthdkata-kataramah. Namunindividuakanberbedadlmmerespontdkhanya pd cue ygbedavariasinya, nmnjgbedaintensitasnya. Ex : responthdkata-kataramah dg nada keras, akanberbedajika dg nada ygpelan/kalem. • Respon adalah segala aktivitas yang dilakukan oleh organisme. Suatu respon biasanya bisa didahului oleh respon lain terlebih dahulu (initial hierarchy of response). • Reinforcement Reinforcement menurut Dollard dan Miller sebagai drive peredadorongan(drive reduction). Reduksi drive menjadisyaratmutlakdari reinforcement.

  13. 3. Model Konflik… • Gradient of approach, kecenderunganutkmendekatitujuansemakinkuatsaatindividusemakindekat dg tujuanitu. • Gradient of avoidance, kecenderunganmenjauhisuatu stimulus negatifsemakinkuatketikaindividusemakindekat dg stimulus itu. • Perubahantingkatmenjauhilebihtajamdaripadaperubahantingkatmendekati • Meningkatnyadoronganygdiasosiasikan dg mendekatataumenjauhakanberakibatmeningkatnyabobotperubahantingkat pd umumnya • Jikaada 2 responygbersaingmakayglebihkuatakanmuncul. (Aproach-Avoidance, Aproach-Aproach, Avoidance-Avoidance).

  14. Aproach-Avoidance Conflict suatukeadaandimanamuncul stimulus untukmendekatidanmenjauhiobyekatausituasisecarabersamaandanmemilikiintensitas yang sama. Contohnya, seseorangmerasabingungantaramelaporkankecurangan yang dilakukanolehtemannyakarenaituadalahsesuatu yang benar (approach) denganketakutanakandikucilkandaripergaulankarenadianggaptidaksetiakawan (avoidance). Aproach-Aproach Conflict suatukeadaandimanaindividudihadapkanpadasituasidimanaiaharusmemilihsalahsatudariduaobyekatausituasi yang sama-samadiinginkan. Contohnya, seorangmahasiswadiharuskanmemilihsatudariduatema yang diinginkannyasebagaibahanpenelitian. Avoidance-Avoidance Conflict: suatukedaandimanaindividudihadapkanpadaduaalternatif yang sama-samatidakmenguntungkan. Contohnya, sepasangsuamiistridihadapkanpadapilihanuntukberceraiatautetapmenikahdemianak-anakmereka. Jikamerekabercerai, adakemungkinanakanmengganggukestabilanemosianak-anakmereka, namunjikamerekatetapmenikah, merekamerasatidakbahagia.

  15. 4. Proses Mental yglebihtinggi • Generalisasi stimulus • Reasoning • Bahasa (ucapan, pikiran, tulisan, danbahasatubuh) • Secondary drive

  16. 5. Ketidaksadaran Dollard dan Miller memandangpentingfaktorketidaksadarantetapiberbedadengan Freud. Dollard dan Miller membagiisi-isiketidaksadaranmenjadidua, yaitupertama, ketidaksadaranberisihal yang tidakpernahdisadari (seperti stimuli, drive danresponyang dipelajari) jugaapa yang dipelajarisecara nonverbal dan detail dariberbagaiketrampilanmotorik. Kedua, berisiapa yang pernahdisadaritetapitidakbertahandanmenjaditidakdisadarikarenaadanyarepresi.

  17. PERKEMBANGAN KEPRIBADIAN…. 1. Innate equipment Kapasitasperilaku yang terbatas yang dimilikiseorangbayi. Meliputirespon yang ternatasterhadapsuatu stimulus tertentuserta primary drive yang dimilikinya. Refleksspesifik(specific reflexes), Refleksbawaan yang hirarki(innate hierarchies of response), Dorongan primer (primary drive) 2. KonteksSosial Dollard dan Miller menekankansalingketergantunganantaratingkahlakudenganlingkungansosiokultural. Bagi Dollard dan Miller, prinsip–prinsipbelajarnyadapatditerapkanlintasbudaya. Dollard dan Miller yakinbahwatingkahlakuorangdipengaruhiolehmasyarakatnya.

  18. 3. Situasipembelajaran

  19. Bagaimana habit terbentukmenurutteoristlumus-responDolard& Miller..? • Apaygdimaksud primary drive dan secondary drive? berikancontohnya..!! • Apaygdimaksud primary reward dan secondary reward? berikancontohnya..!!