slide1 n.
Download
Skip this Video
Loading SlideShow in 5 Seconds..
Pineapple Benefits in Hindi Se Janiye Swasthvardhak Laabh PowerPoint Presentation
Download Presentation
Pineapple Benefits in Hindi Se Janiye Swasthvardhak Laabh

Loading in 2 Seconds...

play fullscreen
1 / 6

Pineapple Benefits in Hindi Se Janiye Swasthvardhak Laabh - PowerPoint PPT Presentation


  • 384 Views
  • Uploaded on

Kya aap jante hai ki ananas ka juice pine se hamare sharer ka vasa dur hota hai aur isme Vitamin C bhi paya jata hai. Yaha padhiye Pineapple Benefits in Hindi aur janiye iske laabh ke bare mai. http://hrelate.com/pineapple-benefits-in-hindi/

loader
I am the owner, or an agent authorized to act on behalf of the owner, of the copyrighted work described.
capcha
Download Presentation

Pineapple Benefits in Hindi Se Janiye Swasthvardhak Laabh


An Image/Link below is provided (as is) to download presentation

Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author.While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server.


- - - - - - - - - - - - - - - - - - - - - - - - - - E N D - - - - - - - - - - - - - - - - - - - - - - - - - -
    Presentation Transcript
    1. Pineapple Benefits in Hindi: Jane AnanasKeSwasthLabh HRELATE.COM

    2. Thandkemousammaikaiphalaatehai. Lekinjyadatar log thandi me phalkhanapasandnahikarte. Agar aapbhiaesakartehai to ham aapkobata de kiaapapna hi nuksankarrahehai. Thandikedinomai vitamin C se bharpurphalkhane se hamarirogpratirodhakkshamtabadhtihaiaur ham bimarnahipadte. Kuch log sochtehaikithandikemousammaiphalkhane se unhesardi ho jayegi. Lekinaesakuchnahihaibalkiiskevipritthandikedinomaiphalokesevan se pratirodhakshaktibadhtihaiaur ham bimariyo se durrehtehai. Sardikemousammaiananas (pineapple) kibahutbahaarrehtihai. Isskhattemithephal ka upyog salad aur dessert maikiyajatahai. Yeh calcium, fiber, aur vitamin C se bharpurhotahai. Ismebahutkammatramaivasapayajatahai. Shayad hi aapjantehongeisliyeaapkoyehbhibatadekiananassharirkisafaikeliyesabseshresthphalhai. Aaiyejantehaiaese hi kuch Pineapple Benefits in Hindi, ananas se milne wale swasthlabh. hrelate.com

    3. hrelate.com

    4. AnanasKhane Se MilteHaiYehFayde hrelate.com AankhoKiRoshniBadhaye Ananasaankhokeliyebehad hi faydemandhai. Kuchsodhomaiyehbaatsabit ho chukihaiki din mai teen bar issphalkokhane se badhtiumramaiaankhokiroshnikam hone kekhatrakam ho jatahai. HaddiyaMajbutBanaye Ismeprachurmatramai magnesium payajatahaijohaddiyokomajbut banana aursharirkourjapradankarne ka kaamkartahai. Aapkojankaryakinnahihogalekinsirf 1 cup Pineapple Juice pine se dinbharkeliye 73% kipurtihotihai. Badhte hue bacchokoisejarurkhilanachahiye. Yehhaddiyo se sambhandit osteoporosis kisamasyakobhidurkartahai. DilKeRogo Se Bachaye Ananasmai Vitamin C bhiprachurmatramaipayajatahai. Issesharirkipratirodhakkshamtabadhtihaiaursadharanthand se bhisurakshamiltihai. Iskerasmaimoujud antioxidants hridaykisehatbanayerakhtahai. Isseuccharaktchaapbhikamhotahai.

    5. hrelate.com TwachaKeliyelabhdayak Ananasmaimoujud vitamin c, acne treatment keliyebahutfaydemandhotahai. Ananaskosirfkhana hi nahihaibalkiaapiskaistemal tonner kitarahbhikarsaktehai. Bus ananas ka raschehre par lagaeaursukhnekeliyechhod de. Fir chehradho le. Anya Rogo Mai BhiFaydemand Ananasmaibromelainpayajatahaijo gale maikharas, sardi, khansiaurgathiyamaifaydemandhotahai. Yehpachantantrakobhisudhartahai. Niyamitroop se ananas ka ras pine se mutramargkesankramandurhotehai. Hamnebahut bar sunahaikirojanaek apple khane se doctor ke pas nahijanapadtahai. Lekin agar aap apple se bore ho gayehai, lekiniskeswasthfadydepanachahtehai. To aapkobata de ananaske natural diuretic haijoaapkekidnikesahirakhtahai. Pineapple Benefits: MahilaoKoHaiIske Kai Labh MahilaokoAnanaskesevan se kaifaydemiltehai. Isme magnesium, tamba, potassium, phosphorus jaisekhanij, vitamin aurbromelainjaiseaavyashak enzyme mojudhotehai.

    6. hrelate.com Mahavari Mai DardKamKare MahavarikedouranyadiAnanas ka raspiyajaye to dardmairahatmiltihai. Ismebharpurmatramai antioxidant hotahaijokoshikaomai hone walihanikamkartahai. Yehdilkedoure se bhibachavkartahai. Garbhavastha Mai Faydemand Ananasmai folic amlahotahai. Jo garbhavasthamaimadadkartahai. folic amlagarbhmaishisukedimagkeliyeupyukthotahai. Stan Ke Cancer Mai Labhdayak Ananasmaibromelain enzyme hotahaijosharirkipratirodhakshaktibadhatahai. Yehstan ka cancer hone ka khatrabhikamkartahai. Cancer keupchar se sharirkihuihanikobhiananaskamkartahai.