slide1 n.
Skip this Video
Download Presentation
Building the Right Multiple Sequence Alignment.

Loading in 2 Seconds...

play fullscreen
1 / 34

Building the Right Multiple Sequence Alignment. - PowerPoint PPT Presentation

  • Uploaded on

Building the Right Multiple Sequence Alignment. Recognizing The Right Sequences When you Meet Them…. Gathering Sequences: BLAST. Common Mistake: Sequences Too Closely Related. PRVA_MACFU SMTDLLNAEDIKKAVGAFSAIDSFDHKKFFQMVGLKKKSADDVKKVFHILDKDKSGFIEE

I am the owner, or an agent authorized to act on behalf of the owner, of the copyrighted work described.
Download Presentation

PowerPoint Slideshow about 'Building the Right Multiple Sequence Alignment.' - cameo

Download Now An Image/Link below is provided (as is) to download presentation

Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author.While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server.

- - - - - - - - - - - - - - - - - - - - - - - - - - E N D - - - - - - - - - - - - - - - - - - - - - - - - - -
Presentation Transcript

Common Mistake:

Sequences Too Closely Related







:**::*.*******:***:* :****************..::******:***********







:*** ******.******.**** *:************.:******:**




This Alignment Is not Informative about the relation Betwwen TPCC MOUSE and the rest of the sequences.

-A better Spread of the Sequences is needed

Respect Information!

PRVA_MACFU ------------------------------------------SMTDLLN----AEDIKKA

PRVA_HUMAN ------------------------------------------SMTDLLN----AEDIKKA

PRVA_GERSP ------------------------------------------SMTDLLS----AEDIKKA

PRVA_MOUSE ------------------------------------------SMTDVLS----AEDIKKA

PRVA_RAT ------------------------------------------SMTDLLS----AEDIKKA

PRVA_RABIT ------------------------------------------AMTELLN----AEDIKKA


: :*. .*::::









Selecting Diverse Sequences (Opus II)








: *: .: . .* .:*. * ** *: * : * :* * **:**








:** .*:.* .* *: ** :: .* **** **::** **

-A REASONABLE Model Now Exists.

-Going Further:Remote Homologues.


Aligning Remote Homologues

PRVA_MACFU ------------------------------------------SMTDLLNA----EDIKKA

PRVA_ESOLU -------------------------------------------AKDLLKA----DDIKKA

PRVB_CYPCA ------------------------------------------AFAGVLND----ADIAAA

PRVB_BOACO ------------------------------------------AFAGILSD----ADIAAG

PRV1_SALSA -----------------------------------------MACAHLCKE----ADIKTA

PRVB_LATCH ------------------------------------------AVAKLLAA----ADVTAA

PRVB_RANES ------------------------------------------SITDIVSE----KDIDAA




: ::











: . .: .. . *: * : * :* : .*:*: :** .











:: .. :: : :: .* :.** *. :** ::


Going Further…








. : .. . :: . : * :* : .* *. : * .








: . :: : :: * :..* :. :** ::






        • Completely Conserved
        • Conserved For Size and Hydropathy
        • Conserved For Size or Hydropathy








***. ::: .: .. . : . . * . *: *



trybr AEKDKERYKREM---------


* : .* . :






***. :*: .: .. . : . . * . *: *



trybr AEKDKERYKREM---------


* : .* . :





          • GOP/ GEP
          • MATRIX

Substitution Matrices

(Etzold and al. 1993)

Gonnet 61.7 %

Blosum50 59.7 %

Pam250 59.2 %











***. ::: .: .. . : . . * . *: *






* *** .:: ::... : * . . . : * . *: *







-The BEST alignment Method:

Your Brain

The Right Data

-The Best Evaluation Procedure:

Experimental Data (SwissProt)

-Choosing The Sequences Well is Important

-Beware of repeated elements

Multiple Alignment


Multiple Alignment

Know Your Problem: What do you want to do with your MSA
