100+ Tillman et al PowerPoint (PPT) Presentations, Tillman et al PPTs

Tillman et al - PowerPoint PPT Presentation

The Potential to Feed Nitrates to Reduce Enteric Methane Production in Ruminants

The Potential to Feed Nitrates to Reduce Enteric Methane Production in Ruminants. By R A Leng AO, D.Rur.Sc. Emeritus Professor UNE-Armidale. The issues in a nut shell 1. Globally ruminants produce around 80x10 6 tonnes of methane

★ ★ ★ ★ ★

992 views • 64 slides

Tillman et al. Clostridium perfringens amidase

Supplementary Table 1. Number of nucleotide differences among nine Clostridium perfringens strains for partial sequence of the amidase gene (942 bases). Tillman et al. Clostridium perfringens amidase .

★ ★ ★ ★ ★

158 views • 1 slides

N-acetylmuramoyl-L-alanine amidase [Clostridium perfringens ATCC 13124]

Supplementary Fig. 1. Amino acid sequence and predicted domains of the expressed protein. N-acetylmuramoyl-L-alanine amidase [Clostridium perfringens ATCC 13124] Sequence ID: ref|YP_696189.1| Length: 337 1 MKIAVRGGHNFKAKGALGIIDETIENRKVYKALIKYLNIAGHNVIDVTPGECDINTDLYL 60

★ ★ ★ ★ ★

134 views • 1 slides

Supplementary Table 2. R esults of mass spectrometry analyses

Supplementary Table 2. R esults of mass spectrometry analyses for the purified recombinant protein. Tillman et al. Clostridium perfringens amidase.

★ ★ ★ ★ ★

90 views • 1 slides

View Tillman et al PowerPoint (PPT) presentations online in SlideServe. SlideServe has a very huge collection of Tillman et al PowerPoint presentations. You can view or download Tillman et al presentations for your school assignment or business presentation. Browse for the presentations on every topic that you want.

'Tillman et al' presentation slideshows

Tillman et al - PowerPoint PPT Presentation

The Potential to Feed Nitrates to Reduce Enteric Methane Production in Ruminants

Tillman et al. Clostridium perfringens amidase

N-acetylmuramoyl-L-alanine amidase [Clostridium perfringens ATCC 13124]

Supplementary Table 2. R esults of mass spectrometry analyses