rocco
Uploaded by
23 SLIDES
925 VIEWS
240LIKES

Protein kinases

DESCRIPTION

Protein kinases. Before we describe how protein kinases work, first an interlude dealing with the representation of protein structure. Proteins are made of a chain (or chains ) of covalently bound amino acids.

1 / 23

Download Presentation

Protein kinases

An Image/Link below is provided (as is) to download presentation Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author. Content is provided to you AS IS for your information and personal use only. Download presentation by click this link. While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server. During download, if you can't get a presentation, the file might be deleted by the publisher.

E N D

Presentation Transcript


  1. Protein kinases Before we describe how protein kinases work, first an interlude dealing with the representation of protein structure

  2. Proteins are made of a chain (or chains) of covalentlyboundaminoacids

  3. Proteins are made of a chain (or chains) of covalentlyboundaminoacids

  4. The -N-C-C-N-C-C- acts as the main chain or « backbone » the atom groups thatdefine the type of aminoacidform the « sidechains » Backbone representation

  5. The string of aminoacidsfoldseither in the form of a helix, a b-strand or as a non-structuredloop (not shown)

  6. An example of a short polypeptide comprisinga-helices, b-sheets and loops loop a-helix b-sheet

  7. The aminoacidsequence of a protein kinase >P06213| 1023-1298 (=275 amino acids) ...ITLLRELGQGSFGMVYEGNARDIIKGEAETRVAVKTVNESASLRERIEFLNEASVMKGFT CHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSLRPEAENNPGRPPPTLQEMIQMAAE IADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRW MAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDQPDNCP ERVTDLMRMCWQFNPKMRPTFLEIVNLLKDDLHPSF…

  8. The folded string of the aminoacidsthatconstitute a protein kinase canberepresented in differentways Show all atoms of the amino acid in a stick representation Show only the back-bone of the amino acid in a ribbon representation Show all atoms of the amino acid in a sphere representation Show the surface of the protein

  9. Phosphorylation and dephosphorylation : protein kinases and protein phosphatases

  10. Protein kinases What do they do? What do they look like? How do they do it?

  11. This iswhatthey do

  12. This is what they look like Understanding enzymes as nano-machines; ATP isnicelyburiedinside the protein kinase whereas the substrate (only a short peptide shown in blue) isfixed onto the surface of the protein The tyrosine residue, shown in green, isperfectlypositioned to receive the g-phosphate tyrosine containing substrate ATP

  13. This is what they look like Understanding enzymes as nano-machines; Protein kinases have two lobes, the upper one is the N-terminal lobe, the bottom one the C-terminal lobe. the catalyticcleftsitsat the interphase between the two; the calaticresidue (not shown) as well as ATP reside in the cleft (ready for action) N-terminal lobe ATP catalytic cleft C-terminal lobe

  14. Understanding enzymes as nano-machines; A ribbonrepresentationtwoillustrate the position of highlyconservedaminoacids As theirlevel of conservation indicates, theseaminoacids are vital for the functioning of the protein kinase They control the position of ATP (lys, asp, glu), substrate (blueribbon) and the transfer of electrons (asp*) leading to hydrolysis of ATP *

  15. And thisis how they do it(understanding enzymes as nano-machines)

  16. serine/threonine versus tyrosine protein kinases

  17. Certain protein kinases are multidomain enzymes

  18. Kinases exist in an incompetent state and require activation beforetheycanphosphorylatesubstrate

  19. Different modes of activation of protein kinases

More Related
SlideServe
Audio
Live Player
Audio Wave
Play slide audio to activate visualizer