neorah
Uploaded by
38 SLIDES
709 VIEWS
400LIKES

Fold Recognition

DESCRIPTION

Bioinformatics Subtopics. Secondary Structure Prediction. Fold Recognition. Homology Modeling. Docking & Drug Design. E-literature. Function Class- ification. Sequence Alignment. Expression Clustering. Protein Geometry. Database Design. Gene Prediction. Large-Scale Genomic Surveys.

1 / 38

Download Presentation

Fold Recognition

An Image/Link below is provided (as is) to download presentation Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author. Content is provided to you AS IS for your information and personal use only. Download presentation by click this link. While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server. During download, if you can't get a presentation, the file might be deleted by the publisher.

E N D

Presentation Transcript


  1. Bioinformatics Subtopics SecondaryStructurePrediction FoldRecognition HomologyModeling Docking &Drug Design E-literature FunctionClass-ification SequenceAlignment Expression Clustering ProteinGeometry DatabaseDesign GenePrediction Large-ScaleGenomicSurveys Structural Informatics StructureClassification GenomeAnnotation

  2. Databases NCBI GenBank- Protein and DNA sequence NCBI Human Map - Human Genome Viewer NCBI Ensembl - Genome browsers for human, mouse, zebra fish, mosquito TIGR - The Institute for Genome Research SwissProt - Protein Sequence and Function ProDom - Protein Domains Pfam - Protein domain families ProSite - Protein Sequence Motifs Protein Data Base (PDB) - Coordinates for Protein 3D structures SCOP Database- Domain structures organized into evolutionary families HSSP - Domain database using Dali FlyBase WormBase PubMed / MedLine Sequence Alignment Tools BLAST Clustal MSAs FASTA PSI-Blast Hidden Markov Models 3D Structure Alignments / Classifications Dali VAST PRISM CATH SCOP Some Specific “Informatics” toolsof Bioinformatics

  3. Databases NCBI GenBank- Protein and DNA sequence NCBI Human Map - Human Genome Viewer NCBI Ensembl - Genome browsers for human, mouse, zebra fish, mosquito TIGR - The Institute for Genome Research SwissProt - Protein Sequence and Function ProDom - Protein Domains Pfam - Protein domain families ProSite - Protein Sequence Motifs Protein Data Base (PDB) - Coordinates for Protein 3D structures SCOP Database- Domain structures organized into evolutionary families HSSP - Domain database using Dali CATH Database FlyBase WormBase PubMed / MedLine Sequence Alignment Tools BLAST Clustal MSAs FASTA PSI-Blast Hidden Markov Models 3D Structure Alignments / Classifications Dali CATH SCOP VAST PRISM Some Specific “Informatics” toolsof Bioinformatics

  4. Dynamic Programming Algorithm: Alternate TracebacksCorrespond to Alternative Alighments A B C - N Y R Q C L C R - P MA Y C Y N - R - C K C R B P

  5. } “Twilight zone” Sequence Similarity May Miss Functional Homologies Which Can Be Detected by3D Structural Analysis % Sequence Identity Homologous 3D Structure Non-homologous 3D Structure Residues Aligned Adapted from Chris Sander

  6. Structural Validation of Homology 19% Seq ID Z = 12.2 Adenylate Kinase Guanylate Kinase

  7. Asp tRNA Synthetase Staphylococcal Nuclease CspA Gene 5 ssDNA Binding Protein Topoisomerase I CspB

  8. Protein Domains “Independent Folding Units” 50 - 350 residues Mean size - 125 residues Alpha folds; Beta Folds; Alpha+Beta Folds; Alpha/Beta Folds

  9. COG 272, BRCT family P. Bork et al

  10. Cadherins courtesy of C. Chothia

  11. Principal Protein Fold Classes All beta All alpha alpha + beta alpha / beta

  12. Classification of Protein Folds • SCOP • CATH • DALI / FSSP

  13. Most proteins in biology have been produced by the duplication, divergence and recombination of the members of a small number of protein families. courtesy of C. Chothia

  14. Average Domain Size: 170 residues courtesy of C. Chothia

  15. SCOP - Protein Fold HierarchyManually Curated Database of Domain Structures Class - 5 Fold - ~500 Superfamily - ~ 700 Family ~ 1000 Family - domains with common evolutionary origin Homology: Derived by evolutionary divergence

  16. Five Principal Fold Classes All a folds All b folds a + b folds a / b folds small irregular folds

  17. courtesy of C. Chothia

  18. courtesy of C. Chothia

  19. courtesy of C. Chothia

  20. courtesy of C. Chothia

  21. courtesy of C. Chothia

  22. courtesy of C. Chothia

  23. CATH Protein Domain DatabasePartially Automatic Fold Classificaiton CATH is a hierarchical classification of protein domain structures, which clusters proteins at four major levels, Class(C), Architecture(A), Topology(T) and Homologous superfamily (H). Orengo, C.A., Michie, A.D., Jones, S., Jones, D.T., Swindells, M.B., and Thornton, J.M. (1997) CATH- A Hierarchic Classification of Protein Domain Structures. Structure. Vol 5. No 8. p.1093-1108. Pearl, F.M.G, Lee, D., Bray, J.E, Sillitoe, I., Todd, A.E., Harrison, A.P., Thornton, J.M. and Orengo, C.A. (2000) Assigning genomic sequences to CATH Nucleic Acids Research. Vol 28. No 1. 277-282

  24. CATH Protein Domain DatabasePartially Automatic Fold Classification Class, derived from secondary structure content, is assigned for more than 90% of protein structures automatically. Architecture, which describes the gross orientation of secondary structures, independent of connectivities, is currently assigned manually. The topology level clusters structures according to their topological connections and numbers of secondary structures. The homologous superfamilies cluster proteins with highly similar structures and functions. The assignments of structures to topology families and homologous superfamilies are made by sequence and structure comparisons.

  25. Representations of Protein Stuctures a - full atom b,c - strands / helices d - Topology diagrams

  26. Structural Alignment of Two Globins

  27. Hb Structure-based Sequence Alignments Alignment of Individual Structures Fusing into a Single Fold “Template” Mb Hb VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHF-DLS-----HGSAQVKGHGKKVADALTNAV ||| .. | |.|| | . | . | | | | | | | .| .| || | || . Mb VLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDLKKHGVTVLTALGAIL Hb AHVD-DMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYR------ | | . || | .. . .| .. | |..| . . | | . ||. Mb KK-KGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDIAAKYKELGYQG Elements: Domain definitions; Aligned structures, collecting together Non-homologous Sequences; Core annotation Previous work: Remington, Matthews ‘80; Taylor, Orengo ‘89, ‘94; Artymiuk, Rice, Willett ‘89; Sali, Blundell, ‘90; Vriend, Sander ‘91; Russell, Barton ‘92; Holm, Sander ‘93; Godzik, Skolnick ‘94; Gibrat, Madej, Bryant ‘96; Falicov, F Cohen, ‘96; Feng, Sippl ‘96; G Cohen ‘97; Singh & Brutlag, ‘98

  28. Some Similarities are Readily Apparent others are more Subtle Easy:Globins 125 res., ~1.5 Å Tricky:Ig C & V 85 res., ~3 Å Very Subtle: G3P-dehydro-genase, C-term. Domain >5 Å

  29. Automatically Comparing Protein Structures Given 2 Structures (A & B), 2 Basic Comparison Operations • Find an Alignment between A and B based on their 3D coordinates 2 Given an alignment optimally SUPERIMPOSE A onto B Find Best R & T to move A onto B

  30. Distance Matices Provide a 2D Represenation of the 3D Structure

  31. Explain Concept of Distance Matrix on Blackboard N x N distance matrix Antiparallel beta strands Parallel beta strands Helices N dimensional space Metric matrix Mij = Dij2 - Dio2 - Djo2 M Eigenvectors (M = 3 for 3D structure)

  32. DALI: Protein Structure Comparison by Alignment of Distance MatricesL. Holm and C. Sander J. Mol. Biol. 233: 123 (1993) • Generate Ca-Ca distance matrix for each protein A and B • Decompose into elementary contact patterns; e.g. hexapeptide-hexapeptide submatrices • Systematic comparisons of all elementary contact patterns in the 2 distance matrices; similar contact patterns are stored in a “pair list” • Assemble pairs of contact patterns into larger consistent sets of pairs (alignments), maximizing the similarity score between these local structures • A Monte-Carlo algorithm is used to deal with the combinatorial complexity of building up alignments from contact patterns • Dali Z score - number of standard deviations away from mean pairwise similarity value

  33. Dali Domain DictionaryDeitman, Park, Notredame, Heger, Lappe, and Holm Nucleic Acids Res. 29: 5557 (2001) • Dali Domain Dictionary is a numerical taxonomy of all known domain structures in the PDB • Evolves from Dali / FSSP Database Holm & Sander, Nucl. Acid Res. 25: 231-234 (1997) • Dali Domain Dictionary Sept 2000 • 10,532 PDB enteries • 17,101 protein chains • 5 supersecondary structure motifs (attractors) • 1375 fold types • 2582 functional families • 3724 domain sequence families

  34. Explain Concept of Distance Matrix on Blackboard N x N distance matrix N dimensional space Metric matrix Mij = Dij2 - Dio2 - Djo2 Eigenvectors of metric matrix Principal component analysis

  35. A Global Representation of Protein Fold SpaceHou, Sims, Zhang, Kim, PNAS 100: 2386 - 2390 (2003) Database of 498 SCOP “Folds” or “Superfamilies” The overall pair-wise comparisons of 498 folds lead to a 498 x 498 matrix of similarity scores Sijs, where Sij is the alignment score between the ith and jth folds. An appropriate method for handling such data matrices as a whole is metric matrix distance geometry . We first convert the similarity score matrix [Sij] to a distance matrix [Dij] by using Dij = Smax - Sij, where Smax is the maximum similarity score among all pairs of folds. We then transform the distance matrix to a metric (or Gram) matrix [Mij] by using Mij = Dij2 - Dio2 - Djo2 where Di0, the distance between the ith fold and the geometric centroid of all N = 498 folds. The eigen values of the metric matrix define an orthogonal system of axes, called factors. These axes pass through the geometric centroid of the points representing all observed folds and correspond to a decreasing order of the amount of information each factor represents.

  36. A Global Representation of Protein Fold SpaceHou, Sims, Zhang, Kim, PNAS 100: 2386 - 2390 (2003)

More Related