Download
topik n.
Skip this Video
Loading SlideShow in 5 Seconds..
TOPIK : PowerPoint Presentation

TOPIK :

157 Views Download Presentation
Download Presentation

TOPIK :

- - - - - - - - - - - - - - - - - - - - - - - - - - - E N D - - - - - - - - - - - - - - - - - - - - - - - - - - -
Presentation Transcript

  1. SISTEM MANAJEMAN DATA B. Sundari, SE., MM. FakultasEkonomi UniversitasGunadarma TOPIK : PendekatanManajamen Data Sistem Basis Data Terpusat 3 Model DBMS Basis Data DalamLingkunganTerdistribusi Pengendalian & Audit SistemManajemen Data

  2. PendekatanManajemen Data Terdapatduapendekatanumumdalammanajemen data : Model File datar Model Basis data

  3. Model File datar Pendekatan model file datarseringdisebutdengansistemwarisan (legacy system). Model inidiimplementasikanpadaakhirth 1960-an hingga 1980-an. Model file datarmenggambarkansuatulingkungandimana file data individual tidakberhubungandengan file lainnya. Penggunaakhirdalamlingkunganinimemiliki file datanyadantidakberbagidenganpenggunalainnya. Sehinggaproses data dilakukanolehaplikasi yang berdirisendiribukanolehsistem yang terintegrasi.

  4. TerdapatRedudansi (duplikasi) data : Redudansi data menyebabkan 4 masalah yang signifikan, yaitu : Penyimpanan data (data storage) Pembaruan data ( data updating ) Kekinian data (currency of information) Ketergantungan Data-Tugas (Aksesterbatas)

  5. data storage Sisteminformasi yang efisienmenangkapdanmenyimpan data hanyasatu kali danmembuatsumbertunggalbagisemuapengguna. Dalamlingkungan file datar, halinitidakmemungkinkan. Untukmemenuhikebutuhan data dari masing-2 pengguna, perusahaanharusmengeluarkanbiayauntukprosedurpengumpulanmajemukdanpenyimpananmajemuk. Beberapa data ygseringdigunakandapatdiduplikasilusinan, ratusan, ataubahkanribuan kali.

  6. data updating Perusahaan menyimpansejumlahbesar data di file master dan file rujukanygmemerlukanpembaharuanberkalauntukmencerminkan perubahan-2. Contoh : perubahanpadanamaataualamatpelangganharustercemindalam file master ygsesuai. Ketikaparapenggunamenyimpan file yang terpisah, semuaperubahanharusdibuatsecaraterpisahjugauntuk masing-2 pengguna. Hal inimengakibatkanpenambahanygsignifikanpadabebantugas & biayamanajemen data.

  7. currency of information Kegagalanuntukmemperbaharuisemua file penggunaygterpengaruholehperubahan status. Jikainformasipembaharuantidakdisebarkansecaratepat, perubahantersebuttidakakantercermindalambeberapa data pengguna, sehinggakeputusanakandidasarkanpadainformasi yang lama.

  8. Aksesterbatas Ketidakmampuanpenggunauntukmemperolehinformasitambahanketikakebutuhannyaberubah. Para penggunabertindaksecaraterpisah; merekatidakberinteraksisebagaisesamaanggotadarisuatumasyarakatapengguna. Dalamlingkunganinisasngatsulitmembentukmekanismeuntukpembagian data secara formal. Hal inimenghambatwaktu, menghambatkerja, menambahredudansi data, danmembuatbiayamanajemen data menjadilebihtinggi. Aksesterbatas yang dihasilkanjugamenghambatpembagian data antaraparapengguna.

  9. Model Basis data Data base management system – DBMS, adalahsistempirantilunakkhusus yang diprogramuntukmengetahuielemen data manasaja yang bolehdiaksesoleh masing-2 pengguna. Program penggunamengirimpermintaan data ke DBMS, kemudianmemvalidasidanmengotorisasiakseske basis data sesuaidengantingkatotoritaspenggunatersebut. Jikapenggunameminta data ygtidakbolehdiakses, permintaantsbakanditolak. Prosedurorganisasidlmmenetapkanotorisasipenggunamerupakanpengendalian yang pentinguntukdipertimbangkanoleh auditor.

  10. Model Basis data

  11. Model Basis data Pendekataninimemusatkan data perusahaandalamsatu basis data umum yang salingdigunakanbersamaataudibagipakai (shared) denganpenggunalainnya. Melaluipenggunaan data secarabersama, masalahtradisionalygadapadapendekatan file datardapatdiatasi : Eliminasimasalahpenyimpanan data Eliminasimasalahpembaharuan data Eliminasimasalahkekinian data Eliminasimasalahketergantungan data tugas

  12. Eliminasimasalahpenyimpanan data Setiapelemen data disimpanhanyasatu kali, sehinggamengurangiredudansi data sertamengurangibiayapengumpulandanpenyimpanan data.

  13. Eliminasimasalahpembaharuan data Karenasetiapelemen data hanyamunculdisatulokasi, makaprosedurpembaharuanhanyaperludilakukansatu kali. Hal inimengurangiwaktudanbiayauntukmenjagakekinian data.

  14. Eliminasimasalahkekinian data Satuperubahanterhadapatribut data akansecaraotomatistersediabagisemuapenggunadariatributtersebut.

  15. Eliminasimasalahketergantungan data tugas Masalahyg paling mencolokantara model basis data dan model file dataradalahpenyatuan data kedalamsatu basis data umumygsalingdibagiolehsemuapenggunadalamperusahaan. Denganakseske domain penuhdari data entitas, perubahan-2 padakebutuhaninformasipenggunadapatdipenuhitanpaharusmengambilserangkaian data khusustambahan. Para penggunahanyadibatasiolehketersediaan data untukentitastersebutdanlegitimasidarikebutuhanmerekauntukmengaksesnya.

  16. SISTEM BASIS DATA TERPUSAT Pembagianlingkungan basis data : DBMS Pengguna Administrator basis data Basis data fisik

  17. DBMS Fitur-fiturygumumdalam DBMS : Pengembangan program. DBMS berisipirantilunakpengembanganaplikasi. Pembuatancadangandanpemulihan. Selamapemrosesan, DBMS secaraperiodikmembuatsalinancadangan (back up) dari basis data fisik. Jikaterjadibencana, DBMS dapatpulihkembalikeversiyglebihawalygdianggapbenar. Pelaporanpenggunaan basis data. Fiturinimenangkapstatistikmengenai data apasajaygdigunakan, kapan, dansiapaygmenggunakan. Akses basis data. Mengizinkanpenggunaygmemilikiotorisasiuntukmengakses basis data secara formal dan informal.

  18. Pengguna Penggunamengakses data dengan 2 cara : • Aksesdimungkinkanolehantarmuka (interface) aplikasi formal. Aplikasiygdisiapkanolehprofesionalsistem, mengirimpermintaanakses data DBMS, ygmemvalidasipermintaantsbdanmenelusuri data untukdiproses. Dengancaraini DBMS transparanbagiparapengguna. • Metodepermintaan data secara informal. Para penggunadapatmengakses data melaluipermintaanlangsung, ygtidakmemerlukanaplikasi formal. DBMS memilikifasilitaspermintaan data ygmemungkinkanpenggunaygmemilikiotorisasiuntukmemproses data tanpabergantungpadaprogramerprofesional.

  19. 3 Model DBMS Model data adalah : Representasiabstrakdari data mengenaientitas, termasuksumberdaya (aset), peristiwa (transaksi), danpelaku (personalia, pelanggan, dsb.) danhubunganmerekadalamperusahaan. Tujuandari model data adalah : Untukmenyajikanatributentitasdengancaraygmudahdipahamiolehpengguna. Bentuk model yang umumadalah : Model Hierarkis Model Jaringan Model Relasional

  20. Model Hierarkis Model inimencermin-kanbanyakaspekperusahaan yang hubungan-nyabersisfathierarkis.

  21. Model Jaringan Adalah basis data navigasionaldenganhubunganeksplisitantara record dan file.

  22. Model Relasional Model relasionalmenampilkan data dalambentuktabelduadimensi

  23. Basis Data DalamLingkunganTerdistribusi Basis data terdistribusiterdiriatasduakategori : • Basis data terpusat • Basis data terdistribusi, terdiriatas : • Basis data terpartisi • Basis data tereplikasi

  24. Basis data terpusat

  25. Basis data terdistribusi - terpartisi

  26. Basis data terdistribusi - Tereplikasi

  27. Pengendalian & Audit SistemManajemen Data Pengendalianatassistemmanajemen data terdiriatas 2 kategoriumum : Pengendalianakses, didesainuntukmencegahindividuygtidakmemilikiotoritasuntukmelihat, menelusuri, mengorupsi, atau , merusak data entitas. Pengendaliancadangan, memastikanbahwajikaterjadikehilangan data karenaaksesygtidakdiotorisasi, kegagalanalat, ataubencanafisik, perusahaandapatmemulihkan basis datanya.

  28. Pengendalianakses Beberapafiturpengendalianakses : Tampilanpengguna, membatasiaksespenggunakeserangkaian data ygterbatas. Tabelotorisasi basis data, berisiaturanygmembatasitindakanygbisadiambilolehpengguna. Prosedurygdidefinisikanolehpengguna, memungkinkanpenggunauntukmenciptakan program keamananpribadiataurutinitasuntukmenyediakanidentifikasipengguna. Enkripsi data, menggunakanalgoritmauntukmengacak data tertentusehinggatidakbisadibacaolehpenyusup Peralatanbiometrik, ygmengukurberbagaikarakteristikpribadi, sepertisidikjari, suara, retina, atautandatangan. PengendalianInfersi, aksesberuparingkasan data rahasia

  29. Tujuan Audit – PengendalianAkses: Memverifikasibahwaotoritasakses basis data danhakkhususdiberikankeparapenggunasesuaidengankebutuhanlogismereka

  30. Prosedur Audit – PengendalianAkses: • Tanggungjawabuntuktabelotoritasdansubskema, auditor hrs memverifikasibhwpersoneladm basis data mempertahankan t-jawabygeksklusifuntukmembuattabelotorisasi & mendesaintampilanpengguna. • OtoritasAksesygsesuai, Auditor bisamemilihsampelpengguna & memverifikasibahwahakaksesmerekaygdisimpandalamtabelsesuai dg fungsiorganisasimereka. • Pengendalianbiometrik, Auditor harusmengevluasibiaya & manfaatdaripengendalianbiometrik. • Pengendalianinferensi, Auditor harusmemverifikasibahwapengendalianpermintaan data ke basis data adauntukmencegahaksesygtdkdimilikiotorisasimelaluiinferensi. • PengendalianEnkripsi, Auditor harusmemverifikasibahwa data ygsensitifdienkripsidenganbaik.

  31. PengendalianCadangan Teknikcadanganygdigunakan, tergantungpada media & struktur file. File berurutanmenggunakanteknikpembuatancadanganygdisebutgrand-parent-child (GPC). File akseslangsung, memerlukanprosedurpembuatancadangansecaraterpisah.

  32. Tujuanaduit – Pengendaliancadangan Memverifikasibahwapengendalianpembuatancadanganygditerapkanefektifdalammelindungi file data darikerusakanfisik, kehilangan, penghapusanygtidakdisengaja, dankorupsi data karenakegagalansistemdankesalahan program.

  33. Prosedur Audit – Pengendaliancadangan GPC, Auditor harusmemilihsampelsistemdanmenentukandaridokumentasisistembahwajumlah file cadangan GPC ygditentukandalamsetiapsistemmemadai. File transaksicadangan, Auditor harusmemverifikasimelaluiobservasifisikbahwa file transaksiygdigunakanuntukmerekontruksi file utamajugadipertahankan. Cadangan file akseslangsung, Auditor harusmemilihsampelaplikasi & mengidentifikasi file akseslangsungygdiperbaharuidalamsetiapsistem. Penyimpananditempat lain, Auditor harusmemverifikasikeberadaan & kelayakanpenyimpananditempat lain.

  34. Sekian, bacalagikalaubelumpaham, ya..??