1 / 1

Relative Luciferase activity

This study evaluates the impact of various Gal4 DNA-binding domain (DBD) constructs on β-Galactosidase activity and relative luciferase expression in yeast and BHK21 cells. We analyze the incubation periods and concentrations, including 0.5 to 1μg of Gal4 DBD fused to luciferase, alongside immunocytodetection techniques. The findings reveal how different Gal4 DBD variants influence gene expression, contributing to our understanding of transcriptional regulation in eukaryotic cells.

kelton
Download Presentation

Relative Luciferase activity

An Image/Link below is provided (as is) to download presentation Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author. Content is provided to you AS IS for your information and personal use only. Download presentation by click this link. While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server. During download, if you can't get a presentation, the file might be deleted by the publisher.

E N D

Presentation Transcript


  1. TSP1 CT VWC IGFBP C N * * * * * * * * * * * * * * * * * * * * * * AVEGDNCVFDGVIYRSGEKFQPSCKFQCTCRDGQIGCVPRCQLDVLLPEPNCPAPRKVEVPGECCEKWICGPDEEDSLGGLTL 14 +/- - +++ 12 10 Time of incubation (hours) b-Galactosidase activity in yeast 8 Gal4 DBD-NH2 - - - - 0,5 1 2 4 6 Gal4 DBD-NH3 - - +/- - Gal4 DBD-NH4 Gal4 DBD-NH5 - - - - - - - - 4 2 Gal4 DBD-NH23 - + ++ +++ 0 Gal4 DBD-NH24 + ++ +++ +++ Gal4 DBD-NH25 - - - - Gal4 DBD-NH35 - - - - Gal4 DBD-NH45 - - - - 6HIS NH3 Gal4 DBD Luciferase 5 Gal4 DBD binding sequences in tandem TATA mini Promoter 12,90 Gal4DBD-NH3 9,77 Relative Luciferase activity 2,11 1,00 Immunocytodetection 1ug 100ng 500ng 1ug pFA NH3 NH2 NH3 NH4 NH5 A) CCN3 B) C) BHK21 cells

More Related