Pancreatitis y c ncer pancre tico
Download
1 / 23

- PowerPoint PPT Presentation


  • 98 Views
  • Uploaded on

Pancreatitis y cáncer pancreático. David C Whitcomb MD Ph.D. Profesor de Medicina, Biología Celular y Fisiología y Genética Humana Jefe, División de Gastroenterología, Hepatología y Nutrición Director, Centro de Ciencias Genómicas Universidad de Pittsburgh. Panorama.

loader
I am the owner, or an agent authorized to act on behalf of the owner, of the copyrighted work described.
capcha
Download Presentation

PowerPoint Slideshow about '' - junius


An Image/Link below is provided (as is) to download presentation

Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author.While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server.


- - - - - - - - - - - - - - - - - - - - - - - - - - E N D - - - - - - - - - - - - - - - - - - - - - - - - - -
Presentation Transcript
Pancreatitis y c ncer pancre tico

Pancreatitis y cáncer pancreático

David C Whitcomb MD Ph.D.

Profesor de Medicina, Biología Celular y Fisiología y Genética Humana

Jefe, División de Gastroenterología, Hepatología y Nutrición

Director, Centro de Ciencias Genómicas

Universidad de Pittsburgh


Panorama
Panorama

1. Origen de la pancreatitis

Activación prematura del tripsinógeno

2. Genética de pancreatitis aguda y crónica

Tripsinógeno

SPINK1

CFTR

3. Cáncer pancreático

Ligado a pancreatitis



Histolog a
Histología

Ducto

Islote

Acinis

grasa


Pancreatitis

Páncreas

Pancreatitis

  • Páncreas - un órgano que elabora bicarbonato para neutralizar el ácido gástrico, enzimas para digerir el contenido de los alimentos e insulina para que el cuerpo almacene los nutrientes ingeridos.

  • Pancreatitis aguda- Un agudo y potencialmente mortal enfermedad; se presenta con dolor abdominal severo en la que el páncreas parece digerirse a sí mismo. Generalmente es causada por cálculos biliares, el alcohol o idiopática.

  • Pancreatitis crónica - una cicatrización irreversible del páncreas con la pérdida permanente de la función pancreática que suele causar incesante dolor abdominal.

  • Pancreatitis hereditaria – una forma no usual de pancreatitis aguda o crónica, que se presenta en familias. El riesgo de Ca de páncreas en >50 veces de lo normal.




Pancreatitis cr nica 1995
Pancreatitis crónica: 1995

Progresos médicos: Pancreatitis crónica.

Volume 332(22) 1 Jun 1995 pp 1482-1490

Michael L Steer, Irving Waxman, Steven Freedman

“pancreatitis crónica permanece como un proceso enigmático de patogénesis no clara, curso clínico impredecible y tratamiento no claro”


Or genes de la pancreatitis
Orígenes de la Pancreatitis

  • Pre-1896: Pancreatitis es una infección

  • 1896: Pancreatitis es auto digestión del páncreas

  • 1996: Pancreatitis hereditaria es causada por mutaciones en el gen del tripsinógeno catiónico(PRSS1)


Pancreatitis hereditaria
Pancreatitis hereditaria

Pancreas

  • Pancreatitis hereditaria (PH) es una forma no común de pancreatitis aguda y crónica que se presenta en familias. El riesgo de cáncer pancreático es >50 veces lo normal.

  • Aunque la PH es responsible de sólo el 2.3% de los casos de pancreatitis crónica, el estudio de esta enfermedad ha revolucionado el entendimiento de las enfermedades pancreáticas.


E mail
E-mail

  • Estimado Dr.Whitcomb,

  • Hola. Los médicos piensan que tengo pancreatitis hereditaria debido a que mi papá la tuvo también. Yo no sé mucho, sólo que duele mucho la espalda, los costados y el área del estómago (hablo por experiencia). Estuve en el hospital una vez por eso y fue el pero ataque. Si puede enviarme mayor información, realmente lo aprevciaría. Tengo 12 años y mi padre 42.

  • Que tenga un agradable día Dr.Whitcomb


Parientes con ph sin enlace 7q35
Parientes con PHsin enlace 7q35

Una gran familia fue identificada por auto-referencia

71 miembros

6 afectados

2 portadores


Enlace de ph al cromosoma 7q35
Enlace de PH al cromosoma 7q35

Whitcomb et al. GASTROENTEROLOGY 110:1975, 1996

0.00001

5

Cromosoma 7

4

0.0001

0.001

3

0.01

2

0.1

1

LOD Scores

0

Gen de fibrosis quística

(Valor de p)

Gen de

pancreatitis

hereditaria

Gen PH

-5

D7S523

D7S483

D7S461

D7S495

D7S684

D7S661

D7S550

D7S559

D7S505

TCRB

Marcardores en cromosoma 7


Descubrimiento del gen de la pancreatitis

2.Mapeo

genético

3. Mutación

4. Mecanismo

ccaccaccagtcaggcacactctaccaccATGAATCCACTCCTGATCCTTACCTTTGTGG/ACAGCTGC TCgtgagtatcatgccctgcctcaggccccaaccacccccccgttcctggccga

Hereditary

Pancreatitis

gene

Tripsinógeno

DNA

Mutación en la

secuencia de

DNA de

tripsinógeno

Determinación

de la significancia

funcional

Cromosoma 7

Descubrimiento del gen de la pancreatitis

Whitcomb et al 1996

1. Familia

Reclutamiento


Fisiolog a de tripsina
Fisiología de Tripsina

Alimento

sólido

Solid Food

TRIPSINA

Enteroquinasa

Tripsinógeno

Quimiotripsinógeno

Proelastasa

Procarboxipeptidasa

Proenzimas

Tripsina

Quimiotripsina

Elastasa

Carboxipeptidasa

Enzimas

Liquido


Inactivaci n segura de tripsina

Trypsin

-

Tripsina

-

-

-

Trypsin

PSTI

PSTI

H122

Enzimas

Proenzimas

?

Auto digestion

Pancreatitis

Inactivación segura de Tripsina

Tripsinogeno

-

+

(Autoactivación)

Tripsina (wt)

R122

Whitcomb et al, Nature Genetics 1996


Alineamiento y mutaciones de tripsin geno

Ferec 1999

Gorry 1997

Teich 2000

Witt 1999

APFDDDDKIVGGYNCEENSVPYQVSLN

Pfutzet 1999 (+CFTR R117H)

Whitcomb 1996

Alineamiento y mutaciones de tripsinógeno

Whitcomb MCNA 2000

Exon 1signal peptide

CODON 1 10 14

| | |

CT MNPLLILTFVAAAL

AT MNLLLILTFVAAAV

MT MNPFLILAFVGAAV

Chy MAFLWLLSCWALLGTTF

Exon 2 TAP

CODON 15 16 23 29 40 50 60 67

| | | | | | | |

CT AAPFDDDDKIVGGYNCEENSVPYQVSLNSGYHFCGGSLINEQWVVSAGHCYKS

AT A APFDDDDKIVGGYICEENSVPYQVSLNSGYHFCGGSLISEQWVVSAGHCYKS

MT AVPFDDDDKIVGGYTCEENSLPYQVSLN SGSHFCGGSLISEQWVVSAAHCYKT

Chy GCGVPAIHPVLSGLSRIVNGEDAVPGSWPWQVSLQDKTGFHFCGGSLISEDWVVTAAHCGVR

| | || | | | |

Chy# 1 10 2021 30 40 50 57

Exon 3

CODON 68 70 80 90 100 110 120 122 130 140 150 152

| | | | | | || | | | |

CT RIQVRLGEHNIEVLEGNEQFINAAKIIRHPQYDRKTLNNDIMLIKLSSRAVINARVSTISLPTAPPA TGTKCLISGWGNTASSGA

AT RIQ VRLGEHNIEVLEGNEQFINAAKIIRHPKYNSRTLDNDILLIKLSSPAVINSRVSAISLPT APPA AGTESLISGWGNTLSSGA

MT RIQ VRLGEHNIKVLEGNEQFINAAKIIRHPKYNRDTLDNDIMLIKLSSPAVINARVSTISLPT APPA AGTECLISGWGNTLSFGA

Chy TSDVVVAGEFDQGSDEENIQVLKIAKVFKNPKFSILTVNNDITLLKLATPARFSQTVSAVCLPSADDDFPAGTLCATTGWGKTKYNAN

| | | | | | | | | | |

Chy# 62 70 80 90 100102 110 117 120 130 140


Mutaciones prss1 panorama
Mutaciones PRSS1 - Panorama

  • Dos mutaciones son comunes y causantes de enfermedad: PRSS1 R122H y N29I (nuevos números)

  • Individuos con alguna de las dos mutuaciones tienen casi 80% de probabilidad de desarrollar pancreatitis aguda.

  • De aquellos con pancreatitis aguda, la mitad desarrollan pancreatitis crónica

  • 40% con pancreatitis crónica desarrollarán cáncer pancreático a los 70 años de edad (fumadores duplican el riesgo).


Alineamiento y mutaciones spink1 psti

Cambio de

humano a

porcino

Alineamiento y mutaciones SPINK1/PSTI

Pfutzer et al, Gastroenterology, 2000

Comparación de de SPINKI/PSTI de hombre, cerdo y rata.Obsvar;

variaciones observadas en la secuencia de la proteína humana deducida por polimorfismos de alelos.

*; el “sebo” lisina (K) en hombre y cerdo,

y arginina (R ) en rata que proyecta en el paquete específico de tripsina durante la inhibición de la tripsina.

Homología entre humano y porcino de SPINK1 (PSTI) es 71%

Exon 1Exon 2

Codon # 1 10 18 24 29

obs var | | P | | |

human MKVTGIFLLSALALLSLS* GNTGADSLGRE *

Porcine TSPQRE

rat MKVAIIFLLSALALLNLA GNTTAKVIGKK

| |

Peptide # 1 6

Exon 3

Codon # 30 34 40 50 55 60 65

obs var | S |* E S | |

humanAKCYNELNGCTKIYDPVCGTDGNTYPNECVLCFENR * *

porcineATCTSEVSGCPKIYNPVCGTDGITYSNECVLCSENK

ratANCPNTLIGCPRDYDPVCGTDGKTYANECILCFENR

| | | | | |

Peptide # 7 11 20 30 40 42

Exon 4

Codon # 66 70 79

obs var | | |

human KRQTSILIQKSGPC

porcine KRQTPVLIQKSGPC

rat KFGTSIRIQRRGLC

| | |

Peptide # 43 50 56


Mutaci n spink1 psti n34s
Mutación SPINK1 / PSTI N34S

Pfutzer et al, Gastroenterology, 2000

  • Superposición de la estructura porcina SPINK1 (azul) sobre estructura SPINKI humano (modificado para quimiotripsina) (rojo).

Modelo por Andrew Brunskil y William F. Furey


Genotipo fenotipo spink1

100

90

80

ICP

70

SPINK1 N34S / N34S

60

SPINK1 N34S / P55S

50

40

30

20

10

0

0

5

10

15

20

25

30

35

40

45

50

55

60

65

Genotipo-Fenotipo SPINK1

Pfutzer et al, Gastroenterology, 2000

Incidencia acumulada de pancrratitis

SPINK1 N34S

Afectados

(% total)

Edad d ataque de síntoma (años)


Mutaciones spink1 panorama
Mutaciones SPINK1 - Panorama

  • Mutaciones SPINK1/PSTI son comunes en la población (~2%)

  • SPINK1/PSTI están asociados con ICP (~25%).

  • El riesgo asociado a la mutación es bajo (<1%).

  • Modelaje y grupo familiar sugiere que mutaciones SPINK1 modifican la enfermedad.

  • Mutaciones SPINK1/PSTI puede disminuir el umbral para pancreatitis de otros factores ambientales o genéticos, pero no son causantes de enfermedad.

  • La mutación N34S tiene distribución mundial-


Tabaquismo y riesgo de c ncer en hp

80

70

60

50

40

30

20

10

0

Siempre

fumó

Nunca fumó

Tabaquismo y riesgo de cáncer en HP

A.B. Lowenfels, P. Maisonneuve, D. C.Whitcomb, and

the International Hereditary Pancreatitis Study Group

Edad de dx de

Ca páncreas

Riesgo de Ca pancreático

150

100

50

0

Edad (Años)

Riesgo Relativo

GP

HP + Fumadores

HP