jescie-duncan
Uploaded by
33 SLIDES
523 VIEWS
340LIKES

Practical Protein Sequence Alignment With Algebraic Dynamic Programming

DESCRIPTION

Practical Protein Sequence Alignment With Algebraic Dynamic Programming. Lyle Kopnicky PacSoft Research Group Tim Sheard, Adviser. Bioinformatics. DNA, RNA and proteins are strings Strings contain information Some problems Determine relatedness of strands of DNA

1 / 33

Download Presentation

Practical Protein Sequence Alignment With Algebraic Dynamic Programming

An Image/Link below is provided (as is) to download presentation Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author. Content is provided to you AS IS for your information and personal use only. Download presentation by click this link. While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server. During download, if you can't get a presentation, the file might be deleted by the publisher.

E N D

Presentation Transcript


  1. Practical Protein Sequence Alignment With Algebraic Dynamic Programming Lyle Kopnicky PacSoft Research Group Tim Sheard, Adviser

  2. Bioinformatics • DNA, RNA and proteins are strings • Strings contain information • Some problems • Determine relatedness of strands of DNA • Figure out how RNA folds on itself • Identify proteins in a sample GTTAGCGTGAATCTGTACTGAG

  3. Tools for bioinformatics • Written in a general-purpose programming language such as C • Designed to solve a narrow range of problems • When problem doesn’t fit tool: • Tweak data to fit tool – awkward, inefficient, may not fully solve problem • Write new tools – time consuming, error-prone, require maintenance

  4. The disconnect #ifndef SS strncpy(pgm_name, "gsw", MAX_FN);#else strncpy(pgm_name, "ssw", MAX_FN);#endif standard_pam("BL50",ppst); ppst->nsq = naa; ppst->nsqx = naax; for (i=0; i<=ppst->nsqx; i++) { ppst->sq[i]=aa[i]; /* sq = aa */ ppst->hsq[i]=haa[i]; /* hsq = haa */ ppst->sqx[i]=aax[i]; /* sq = aax */ ppst->hsqx[i]=haax[i]; /* hsq = haax */ } ppst->sq[ppst->nsqx+1] = ppst->sqx[ppst->nsqx+1] = '\0'; memcpy(qascii,aascii,sizeof(qascii)); /* set up the c_nt[] mapping */ ppst->c_nt[0]=0; for (i=1; i<=nnt; i++) { ppst->c_nt[i]=gc_nt[i]; ppst->c_nt[i+nnt]=gc_nt[i]+nnt; }}

  5. The disconnect • General purpose languages are easily available, efficient, BUT • Biologists think: amino acids, matching, classification • General-purpose languages provide characters, procedures, objects • Domain experts may not be expert programmers • A lot of design, development and maintenance time

  6. Bioinformatics Domain Domain Tool Tool Domain Tool Domain Domains and tools General-purpose languages Physics Architecture Finance Mathematics Chemistry

  7. Libraries

  8. Domain-specific languages • Represent a problem in the way domain experts think of it • Examples: Excel, HTML, Matlab • General enough to capture a domain, specific enough to reduce design time • Small change in requirements = small change in program • Easy to answer “what-if” questions • Can be implemented efficiently using known techniques

  9. Collaboration with OHSU lab • Dr. Srinivasa Nagalla’s laboratory • Goals • Gain domain knowledge • Discover goals of biologists • Potential users of DSL • Began with protein identification problem

  10. Protein identification problem breakup into peptides chromatography SD gel ? ? ? ?

  11. Protein identification problem tandem mass spectrometry de novo sequencing database search AVAQFPRR AVAQFPRR AVAQFPRR AVAQFPRR AVAQFPRR ? AVAQF QFPRR [Po]QFPVGR A[AV]QFPVGR [Po]QFPRR [241.10]QFPVGR A[AV]QFPRR AVA …TRSSRAGLQFPVGRVHRLLR… PRR A R [241.10]QFPVGR

  12. Database search • Not an exact match • Mutations – substitutions, insertions, deletions • Modifications – amino acids altered by another molecule • De novo sequencer outputs a list of ambiguous queries, e.g. [229.07]HhNyG[PS][198.1]QHADD[ep]VD[Rz]R unidentified mass unordered pair

  13. Sequence alignment • Find the best match between query string and target (database) string • Each match is also called an alignment • Alignments are scored Target string WTABRRFCWGYPD KWGGSCASPNE F WT PDPYK Query string

  14. Alignment tools • Smith-Waterman dynamic programming algorithm most common • O((n+m)2), where n and m are length of strings • Run on every query-target pair, and data sets are large • Requires precise query string • FASTA, BLAST address speed problem • First look for runs of exact matches • Align on localized area

  15. Fitting queries into FASTA • Generate all possible exact queries • Could be dozens of possibilities [241.10]NEM[NP]YR NQQNGGGANGNAGQGGGQAGGG NP PN • Each one must be aligned – takes time • Output must be converted back to original query string

  16. Algebraic Dynamic Programming • Robert Giegerich, 2000 • Generic approach to solving dynamic programming problems using parsing • Domain-specific embedded language in Haskell • Ambiguous queries can be represented directly as a grammar • Searching with an ambiguous query slower, but only one search instead of dozens • Still takes O((n+m)2) time

  17. Trimming the search space • Filter target strings and localize search • Five-character substring exact match NEMNPNEMPNEMNPYEMPNYMNPYRMPNYR exact [241.10]NEM[NP]YR • Matching techniques • Boyer-Moore on each substring-target pair • Pre-index database

  18. Boyer-Moore • Finds an exact occurrence of one string inside another • Doesn’t check every position – knows when to skip ahead • Can run in sublinear time SYNSNTLNNDIMLIKLKSAASLN xSAASL SYNSNTLNNDIMLIKLKSAASLN x SAASL

  19. Pre-indexing the database • Build a tree in which to look up substrings, find positions in database • Substring tree: A substring at each node • Suffix tree: Path along labeled edges describes substring substring tree suffix tree DTA, 3 TADTA 1 ATD ADTA 3 ADT, 2 TAD, 2 2

  20. Sample output Query string:[229.07]HhNyG[PS][198.1]QHADD[EP]VD[Rz]R:{21}Target string:>MK14_HUMAN (Q16539) Mitogen-activated protein kinase 14MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES:{360}Target range: 290-326LDSDKRITAAQALAHA YFAQYHDPDDEPVADPYDQSF :|XvvvXX:|^|X^||//|^|XXX -HhNyGPS-Q HA DDEPV DRzR Score: 31Time: 0.045 secs

  21. Time and space usage

  22. Smith-Waterman (1981) • Local alignment problem • Dynamic programming algorithm • Pathways through table represent alignments • Entry represents best score of an alignment starting here, ending anywhere

  23. S.-W. alignment scoring start/end = 0 WTABRRFCWTYPDG WKGGSCASPNE GE F WT PDPYDAW QAPT gap: -w x length match/substitution: s(a1,a2)

  24. Smith-Waterman Phase 1 Insertion, deletion or substitution

  25. Smith-Waterman Phase 2 Trace back maximal pathways

  26. Today’s problems one-to-many transpositions W NAC ANNA endpoint scoring dual representations FGAK +5 AGNCF... 85 116 39 85 100... Trying to fit new data into old tools… We need a way to model new problems quickly

  27. Recurrence relations • Basis of traditional DP • Hard to design and understand • Mixes together search space, scoring, and order of evaluation • Subscript errors are common in implementation Smith-Waterman recurrence relation

  28. Algebraic Dynamic Programming • Giegerich, 2000 • Grammars describe search space • Set of functions (evaluation algebra) specifies scoring • Solution space is pared down by an objective function first string $ gnirts dnoces

  29. Grammar & eval. algebra localign = start <<< string ~~~ internal ~~~ string ... h internal = subst <<< aa ~~~ internal ~~~ aa ||| delete <<< aa ~~~ internal ||| insert <<< internal ~~~ aa ||| end <<< string ~~~ ’$’ ~~~ string ... h subst(a1,score,a2) = score + s(a1,a2)insert(score,a) = score – wdelete(a,score) = score – wend(str1,$,str2) = 0h[score1,...,scorek] = max[score1,...,scorek]

  30. Traditional DP vs. ADP

  31. Design of a DSL • Implement sample applications • Use a flexible, higher-order language • Abstract out common themes • Data structures • Operations • Decide how to handle errors • Run-time errors • Type system • Speed up implementation by generating C • From embedded language, like PAN • Using standalone compiler

  32. The next steps • Compare our alignments with biologists’ • Accumulate protein scores • Try 2-3 character statistical matches • Pre-index using suffix trees • Reduce memory usage • Look for runs of exact matches as in FASTA

  33. Our contributions • Built a working relationship with bio lab to understand domain • Demonstrated feasibility of aligning large data sets in Haskell • Constructed a framework for experimenting with representations for alignments, and heuristics for filtering target strings, localizing searches

More Related