bab 4 n.
Skip this Video
Loading SlideShow in 5 Seconds..
BAB 4 PowerPoint Presentation
Download Presentation

Loading in 2 Seconds...

play fullscreen
1 / 27

BAB 4 - PowerPoint PPT Presentation

  • Uploaded on

BAB 4. MENANGKAP DAN KODIFIKASI PENGETAHUAN. REVIEW. 3 tahapan utama dalam sklus manajemen pengetahuan terintegrasi yaitu : 1. Menangkap dan / atau menciptakan pengetahuan . 2. Membagi dan menyebarkan pengetahuan . 3. Mengakuisisi dan aplikasi pengetahuan . REVIEW.

I am the owner, or an agent authorized to act on behalf of the owner, of the copyrighted work described.
Download Presentation

PowerPoint Slideshow about 'BAB 4' - jariah

Download Now An Image/Link below is provided (as is) to download presentation

Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author.While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server.

- - - - - - - - - - - - - - - - - - - - - - - - - - E N D - - - - - - - - - - - - - - - - - - - - - - - - - -
Presentation Transcript
bab 4



  • 3 tahapanutamadalamsklusmanajemenpengetahuanterintegrasiyaitu :
  • 1. Menangkapdan/ataumenciptakanpengetahuan.
  • 2. Membagidanmenyebarkanpengetahuan.
  • 3. Mengakuisisidanaplikasipengetahuan.
  • Babinimembahastahappertamadarisiklusmanajemenpengetahuan, pengetahuanmenangkapdan / ataupenciptaan. Pendekatan, teknik, dantoolsutama yang digunakanuntukmendapatkanpengetahuan tacit, untukmemicupenciptaanpengetahuanbaru, danuntukselanjutnyamengaturkonteninisecarasistematis (kodifikasi) .
  • Menangkappengetahuandalamsebuahorganisasitidakmurnitentangteknologi. Bahkan, banyakperusahaanmenemukanbahwa TI hanyamemainkansebagiankecildalammemastikaninformasi yang tersediabagimereka yang membutuhkannya. Pendekatan yang diperlukantergantungpadajenisusaha, budaya, dancaradimanaorangmemecahkanmasalah.
  • Menangkappengetahuanbukanlahmurnimekanistik "add-on" karenaadahubungannyadenganorganisasi, penemuan, danintegrasipengetahuankedalam “pabrik" dariorganisasi.
  • Pengetahuanharusditangkapdandikodifikasisedemikianrupasehinggadapatmenjadibagiandari basis pengetahuan yang adaorganisasi. Setiaporganisasimemilikisejarah, yang menyediakansuatulatarbelakangterhadappertumbuhandanevolusiorganisasi.
  • Setiaporganisasijugamemilikimemori. Perwujudandarimemoriorganisasiadalahpengalamankaryawannya, dikombinasikandengan data tangible danpengetahuan yang tersimpandidalamorganisasi (Walsh danUngson, 1991).
tacit knowledge capture1

Pembelajaranpadatingkatindividuadalahprosessosial fundamental – sesuatu yang tidakdapatterjaditanpaadabentukinteraksikelompok. Sehinggaindividubelajardarikolektifdanpadasaat yang sama, kolektifbelajardariindividu (Crossan, Lane and White, 1999)

tacit knowledge capture2

Berdasarkan model 4I Crossan, pembelajaranorganisasimelibatkanpenekananantaraasimilasipembelajaranbaru (eksplorasi) danmenggunakanapa yang telahdipelajari (eksploitasi). Level pembelajaranindividu, kelompokdanorganisasidihubungkanolehproses-prosessosialdanpsikologiyaituintuisi, interpretasi, integrasidaninstitusionalisasi (the four I’s).

tacit knowledge capture at individual and group levels
Tacit Knowledge Capture at Individual and Group Levels

Akuisisipengetahuandariindividuataukelompokdapatdikarakteristikansebagaipentransferandanpentransformasiankeahlian yang berharga (valuable expertise) darisumberpengetahuan (sepertikeahlianmanusia, dokumen) kerepositoripengetahuan (seperticorporate memory, intranet). Prosesinimemuatpengurangan volume besarkontendariberbagai domain menjadikumpulanfaktadanaturan yang tepatdanmudahdigunakan.

tacit knowledge capture at individual and group levels1
Tacit Knowledge Capture at Individual and Group Levels

“Idemengakuisisipengetahuandariseorangahlidalambidangtertentuuntuktujuanmerancangpresentasitertentudariinformasi yang diakuisisibukanlahhalbaru. Reporter, wartawan, penulis, penyiardaninstructional designers telahmempraktikkanakuisisipengetahuanselamabertahun-tahun…analissistemmemilikijabatan yang sangatmiripdengantugasdidalamperancangandanpengembangansistemsoftwarekonvensional “(McGraw and Harrison-Briggs, 1989, pp. 8–9).

tacit knowledge capture at individual and group levels2
Tacit Knowledge Capture at Individual and Group Levels

Penelitikecerdasanbuatan, Parsave (1988), mengemukakan 3 pendekatanutamauntukakuisisipengetahuandariindividudankelompok :

  • Mewawancaraiahli (interviewing experts).
  • Pembelajarandengandiberitahu (learning by being told).
  • Pembelajarandenganobservasi (learning by observation).

Ketigapendekatantersebutdapatditerapkanpadapenangkapanpengetahuantacit, tetapitidakadapendekatan yang harusdigunakansecara total denganmengesampingkan yang lain.

Padabanyakkasus, kombinasidaripendekatan-pendekataniniakandiperlukanuntukmenangkappengetahuantacit.


Interviewing ExpertsDuateknik yang paling populeruntukmengoptimisasiwawancaradenganahliyaituwawancaraterstruktur (structured interviewing) dancerita (stories).

Structured Interviewing

Duatipepertanyaan yang digunakandalamwawancarayaitupertanyaanterbukadantertutup.

Pertanyaanterbukakecenderunganmenjadimeluasdanmenempatkansedikitbatasan-batasanpadaahli. Pertanyaanterbukatidakdiikutipilihan-pilihankarenapertanyaantersebutdirancanguntukmendorongjawabanbebas (Oppenheim, 1996). Tipepertanyaaninimemperbolehkanpewawancarauntukmengobservasipenggunaanahlidalamkosakatakunci, konsepdankerangkaacuan. Ahlidapatjugamemberikaninformasi yang tidaksecarakhususditanyakan. Contoh-contohnyasebagaiberikut :

  • “How does that work?”
  • “What do you need to know before you decide?”
  • “Why did you choose this one rather than that one?”
  • “What do you know about . . .”
  • “How could . . . be improved?”
  • “What is your general reaction to . . . ?”

Pertanyaantertutupmenetapkanbatasan-batasanpadatipe, level, danjumlahinformasi yang harusdiberikanolehahli. Alternatifpilihanselaludiberikan. Contohpertanyaantertutup yang bersifatmoderate (sedang) : “which symptom led you to conclude that . . . ?” Pertanyaantertutup yang kuathanyadapatdijawabseseorangdenganjawabanyaatautidak.


Ceritaadalahsarana lain yang sangatbaikuntukmenangkapmaupunmengkodingpengetahuantacit. Ceritaorganisasiadalahnaratifdetildaritindakanmanajemen, interaksikaryawandankejadianintraorganisasilainnya yang dikomunikasikansecara informal didalamorganisasi. Suatuceritadapatdidefinisikansebagaimenceritakanapa yang sedangterjadiataurangkaianterhubungkejadian yang sedangterjadi , baikfaktamaupunfiksi (Dennis 2001).

Snowden (2001) mendefinisikansuatunaratifsebagai : “tidakhanyasekedarmenceritakan, menkonstruksikanataubahkanmemunculkancerita, halinimengenaimemunculkanpolabudaya, kebiasaandanpemahaman yang diperolehdaricerita (p. 1). Suatuceritaorganisasidapatdidefinisikansebagainaratifdetildaritindakanmanajemendimasalalu, interaksikaryawanataukejadian-kejadianpentinglainnya yang telahterjadidantelahdikomunikasikansecara informal (Swap et al., 2001).

learning by being told
Learning by Being Told

Di dalampembelajarandengandiberitahu, yang diwawancaraimengungkapkandanmenyaringpengetahuannyadanpadasaat yang sama, manajerpengetahuanmengklarifikasidanmenvalidasiartifakpengetahuan yang diterjemahkandalambentukeksplisit. Bentukakuisisipengetahuaninimelibatkananalisistugas (task) dan domain, pentelusuranprosesdananalisisprotokolsertasimulasi.

learning by observation
Learning by Observation

Ada paling sedikitduajeniskeahlian yang dapatdilihatyaituketerampilanatauberdasarkangerakan (sebagaicontoh : mengoperasikanpotonganmesin, mengendaraisepeda) dankeahliankognitif (sebagaicontohmembuat diagnosis medis). Keahlian (expertise) adalahdemonstrasidariaplikasipengetahuan. Pendekatanpembelajarandenganobservasimemuatpenyajianahlidenganmasalahsampel, skenarioataustudikasus yang kemudiandiselesaikanolehahli. Walaupunkitatidakdapatmengobservasipengetahuanseseorangtetapikitadapatmengamatidanmengidentifikasikeahlian (expertise). Kuncinyaadalahmenggunakan audio atau video untukmerekamapa yang paraahliketahui.

tacit knowledge capture at the organizational level
Tacit Knowledge Capture at the Organizational Level

Akuisisipengetahuanorganisasiadalahprosesberbedasecarakualitatif yang berasaldariapa yang terjadipada level individudankelompok. Sedangkanpada level kelompok, kitalebihcenderungtertujudenganmengidentifikasidanmengkodingpengetahuanberharga, yang sebagianbesaradalahtacit, penangkapanpengetahuanorganisasiberlangsungpada level yang lebihmakro. Pendekatan yang baikdikemukakanolehMalhotra (2000), yaituada 4 prosesakuisisipengeathuanorganisasiutama :

(1) Grafting (penyambungan), (2) vicarious learning (pembelajaran yang menggantikan), (3) experiential learning (pembelajaran yang berpengalaman), and (4) inferential processes (proses yang dapatdisimpulkan).

tacit knowledge capture at the organizational level1
Tacit Knowledge Capture at the Organizational Level
  • Grafting memuatperpindahanpengetahuanantaraperusahaan. Iniadalahprosespembelajarandimanaperusahaanmemperolehaksesuntukmenugasi-atau-memproses-pengetahuantertentu yang sebelumnyabelumtersediadidalamperusahaan. Hal inibiasanyadiperolehmelaluipenggabungan, akuisisiataualiansi yang didalamnyalangsunglewatantaraperusahaan-perusahaan (Huber 1991). Sebagaicontoh : transfer teknologiataubentuk lain daripengetahuaneksplisit.

(2) Vicarious learning : proses-prosesterjadimelaluisuatuperusahaanmengamatidemonstrasiteknikatauprosedurperusahaan lain.

Contoh : studibenchmarkingdimanaperusahaandapatmengadopsibest practice dariperusahaanpemimpinindustrilainnya.

(3) Akuisisiexperiential knowledge melibatkanakuisisipengetahuandidalamperusahaan-yaitupengetahuandiciptakandenganmelaksanakandanmempraktikkan. Pengulanganberdasarkanpengalamanbergantungpadakurvapembelajaranuntukmembangunrutinitasdanprosedur. Tipepengetahuaninipadamulanyatacittetapidapatdenganmudahdikodifikasidanditransfer (Pennings, BarkemadanDouma, 1994; Starbuck, 1992)

(4) Di dalaminferential process (sebagaicontoh : Mintzberg, 1990), pembelajarandidalamperusahaandanterjadidenganmelakukan/mengerjakan. Namunakuisisipengetahuanterjaditerutamamelaluiinterpretasikejadian, keadaan, perubahandanhasil-hasil yang relatifterhadapaktivitas yang dikerjakandankeputusan yang dibuat. Pembelajaranbersifateksperimen, pembelajarandeduktifberusahauntukmembuatsensedarikejadiandanmembangunhubungankausalantaratindakandanhasil. Tipepembelajaraninikadang-kadangdisebutdouble-loop learningkarenahalinimelibatkanperubahan yang berdasarkanasumsidankerangkakerja (adaptivitasuntukkeefektifan)

tacit knowledge capture at the organizational level2
Tacit Knowledge Capture at the Organizational Level

Hasildarikeempatjenispenangkapanpengetahuanorganisasiakanakhirnyaberadapadasuatujenisrepositoripengetahuan. Repositoriiniadalahpenerimamemoriorganisasidankontainerbiasanyasuatubentukdatabasepada intranet atauekstranet.

explicit knowledge codification

Kodifikasipengetahuanadalahtahapanselanjutnyadarimemperluaspengetahuan. Denganmengubahpengetahuanmenjadibentuk yang eksplisitdantangiblesepertisuatudokumen, yang pengetahuandapatdikomunikasikansecaralebihluasdandengansedikitbiaya. Interaksiterbatasdalamruanglingkupmereka yang dapatmendengarataudapatmelakukankontaktatapmukalangsung. Dokumendapatdisebarkansecaraluasmelalui intranet korporatdanberlangsung lama, yang dapatmembuatnyatersediasebagaireferensidanketikadiperlukan, baikolehstaf yang adadanstafdimasa yang akandatang. Kodifikasipengetahuanmembentukmemorikorporatorganisasi yang “nyata”. Sehinggatentusaja, terdapatkendalabiayadankesulitan-kesulitanterkaitdengankodifikasipengetahuan.

explicit knowledge codification1


mapping, decision trees, danknowledge taxonomies

cognitive maps
Cognitive Maps

Ketikakeahlian (expertise), pengalamandanknow-howtelahdisebarkansecaraeksplisit, biasanyamelaluisuatubentukwawancara, konten yang dihasilkandapatdirepresentasikansebagaipetakognitif. Petakognitifataupengetahuanadalahrepresentasi “model mental” daripengetahuanseseorangdanmemberikanbentuk yang baikdaripengetahuanterkodifikasi. Model mental adalahrepresentasisimbolataukualitatifdarisesuatudalamkehidupannyata. Hal inibagaimanprosespemikiranmanusiadanmembuat sense terhadaplingkungankompleksmereka.

Petakognitifadalahcara yang baikuntukmengkodingpengetahuan yang ditangkapkarenapetajugamenangkapkonteksdanantarhubungan yang kompleksantarakonsep-konsepkunci yang berbeda. Petakognitifberdasarkanpemetaankonsep (Leake et al., 2003), petakonsepmerepresentasikankonsepdanrelasidalambentukgrafikduadimensi, dengannode/titikmerepresentasikankonsepkunci yang dihubungkanolehhubungan-hubungan (links) yang merepresentasikanproposisi. Hal inihampirsamadenganjaringansemantik yang digunakanolehberbagaidisiplinilmusepertilinguistik, pendidikandansistemberbasispengetahuan. Tujuandarisisteminiadalahuntukmengorganisasikanlebihbaikpengetahuaneksplisitdanmenyimpannyadalammemorikorporatuntukpenympananjangkapanjang.

decision trees
Decision Trees

Pohonkeputusanadalahmetode lain yang digunakansecaraluasuntukmengkodifikasipengetahuaneksplisit.

Representasinyatersusunrapat (compact) danefisien. Pohonkeputusanbiasanyadalambentukflowchart, denganjalur (path) alternatifmengindikasikandampakdarikeputusanberbeda yang dibuatpadatitikwaktuitu.

Pohonkeputusandapatmerepresentasikanbanyak “aturan” danketikaandamenjalankanlogikadenganmengikutijalurkebawah, andadenganefektifmelewatiaturan-aturan yang tidakrelevandengankasus yang ditangani. Andatidakharusmelihatpadasetiapaturanuntukmelihatapakahini “tepat/fires” danandajugadapatmengambilruteterpendekuntukhasil yang benar. Bentukgrafiknyamembuatnyamudahdimengertidanpohonkeputusantentusajasangatsesuaiuntukpengkodinganpengetahuanproses. Contohberikutadalahprosesmaintenancepreventifpadaperalatanpabrik.

knowledge taxonomies
Knowledge Taxonomies

Konsepdapatdipandangsebagaiblok-blokbangunanpengetahuandankeahlian. Kita masing-masingmenggunakandefinisi internal kitasendirimengenaikonsepuntukmembuatsenseterhadapduniasekitarkita. Ketikakonsepkuncitelahdiidentifikasidanditangkap, merekadapatdiaturdalamsuatuhierarki yang seringmengacusebagaisuatutaksonomipengetahuanstruktural. Taksonomipengetahuanmembuatpengetahuandapatsecaragambardirepresentasikansehinggamerefleksikankonseporganisasidalambidangkeahliankhususatauuntukorganisasisecaralebihluas.

Kamuspengetahuan (knowledge dictionary) adalahcara yang baikuntukmenjagakonsepdanistilahkunci yang digunakan. Hal inimungkindisusunpadasaatmengakuisisidanmengkodingpengetahuan. Hal iniharussecarajelasdidefinisikandandiklarifikasioleh “jargon” profesionalberdasarkan domain permasalahan. Taksonomiadalahsistemklasifikasidasar yang membuatkitadapatmenggambarkankonsepdanketergantungannya-biasanyadalambentukhierarki. Makin tinggikonsepdiletakkan, makinumumataugenerikkonseptersebut. Makin rendahsuatukonsepditempatkan, makinspesifikhaltersebutpadakategori level tinggi. Konstruksitaksonomimelibatkanidentifikasi, mendefinisikan, membandingkandanmengelompokkanelemen. Ketikamenciptakantaksonomipengetahuanoganisasi, halinisangatpentinguntukmengidentifikasipemilikkonten. Taksonomiinimembantumemastikankontenakanselaluup to date. Organisasiakanjugamemilikiidejelasdarimasing-masinganggotastafsebagaipemilikpengetahuantertentu. Taksonomipengetahuanini (kadang-kadangdisebutpetapengetahuan) jugaharusmemanfaatkan metadata, yang ditandaipada “informasitentanginformasi”-sebagaicontoh : penandaankontendenganpemilikkonten, tanggal “sebaiknyasebelum”, informasiklasifikasisepertikatakunci, informasispesifik-bisnissepertiaudience yang dimaksuddanindustrivertikal yang dituju.

key points
  • Perusahaan perlumengadaptasidanmenyeimbangkankesuatutingkatdimanamerekadapatsurvive.
  • Perusahaan perlubelajar-pertanyaannyaapakahmerekaakanmelaksanakannyadengancaraad hoc informal atauapakahadaniatsengajauntukbelajar.
  • Akuisisipengetahuantiba-tiba (emergent) (Malhotra, 2000) bersifatspontandantidakterencana. Karenahalinisembarangan, tidakadajaminanbahwaadasesuatu yang akantertanamdalammemorikorporatorganisasi.
  • Akuisisipengetahuansecarasengaja, sistematisdanmetodisadalahstrategi yang berhargabagiperusahaan.
  • Dasar-dasarpengetahuanharusdiisidankontendisebarkan agar memaksimumkanefisiensidanefektifitasmelaluiorganisasi.