slide1 n.
Download
Skip this Video
Loading SlideShow in 5 Seconds..
Prof. Riccardo Gavioli e-mail: r.gavioli@unife.it tel: 0532-974407 PowerPoint Presentation
Download Presentation
Prof. Riccardo Gavioli e-mail: r.gavioli@unife.it tel: 0532-974407

Loading in 2 Seconds...

play fullscreen
1 / 100

Prof. Riccardo Gavioli e-mail: r.gavioli@unife.it tel: 0532-974407 - PowerPoint PPT Presentation


  • 181 Views
  • Uploaded on

Prof. Riccardo Gavioli e-mail: r.gavioli@unife.it tel: 0532-974407. Il virus. Problemi per lo sviluppo di un vaccino contro HIV/AIDS. Diversi sottotipi di virus Il virus muta Mancanza di modelli animali Quali risposte immuni sono protettive? Quale parte del virus usare in un vaccino?

loader
I am the owner, or an agent authorized to act on behalf of the owner, of the copyrighted work described.
capcha
Download Presentation

Prof. Riccardo Gavioli e-mail: r.gavioli@unife.it tel: 0532-974407


An Image/Link below is provided (as is) to download presentation

Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author.While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server.


- - - - - - - - - - - - - - - - - - - - - - - - - - E N D - - - - - - - - - - - - - - - - - - - - - - - - - -
    Presentation Transcript
    1. Prof. Riccardo Gavioli e-mail: r.gavioli@unife.it tel: 0532-974407

    2. Il virus

    3. Problemi per lo sviluppo di un vaccino contro HIV/AIDS • Diversi sottotipi di virus • Il virus muta • Mancanza di modelli animali • Quali risposte immuni sono protettive? • Quale parte del virus usare in un vaccino? • Che via di somministrazione usare? • Che adiuvante usare? • Pochi investimenti dell’industria farmaceutica

    4. Sottotipi di HIV

    5. Problemi per lo sviluppo di un vaccino contro HIV/AIDS • Diversi sottotipi di virus • Il virus muta • Mancanza di modelli animali • Quali risposte immuni sono protettive? • Quale parte del virus usare in un vaccino? • Che via di somministrazione usare? • Che adiuvante usare? • Pochi investimenti dell’industria farmaceutica

    6. Il virus muta

    7. Problemi per lo sviluppo di un vaccino contro HIV/AIDS • Diversi sottotipi di virus • Il virus muta • Mancanza di modelli animali • Quali risposte immuni sono protettive? • Quale parte del virus usare in un vaccino? • Che via di somministrazione usare? • Che adiuvante usare? • Pochi investimenti dell’industria farmaceutica

    8. Mancanza di modelli animali

    9. Problemi per lo sviluppo di un vaccino contro HIV/AIDS • Diversi sottotipi di virus • Il virus muta • Mancanza di modelli animali • Quali risposte immuni sono protettive? • Quale parte del virus usare in un vaccino? • Che via di somministrazione usare? • Che adiuvante usare? • Pochi investimenti dell’industria farmaceutica

    10. Risposte immuni contro HIV • Anticorpi • Linfociti helper • Linfociti citotossici MHC-II CD4 T cell TCR MHC-I CTL TCR

    11. Problemi per lo sviluppo di un vaccino contro HIV/AIDS • Diversi sottotipi di virus • Il virus muta • Mancanza di modelli animali • Quali risposte immuni sono protettive? • Quale parte del virus usare in un vaccino? • Che via di somministrazione usare? • Che adiuvante usare? • Pochi investimenti dell’industria farmaceutica

    12. Problemi per lo sviluppo di un vaccino contro HIV/AIDS X ? Proteine strutturali ? ? Proteine regolatorie

    13. Problemi per lo sviluppo di un vaccino contro HIV/AIDS • Diversi sottotipi di virus • Il virus muta • Mancanza di modelli animali • Quali risposte immuni sono protettive? • Quale parte del virus usare in un vaccino? • Che via di somministrazione usare? • Che adiuvante usare? • Pochi investimenti dell’industria farmaceutica

    14. Vie di somministrazione

    15. Problemi per lo sviluppo di un vaccino contro HIV/AIDS • Diversi sottotipi di virus • Il virus muta • Mancanza di modelli animali • Quali risposte immuni sono protettive? • Quale parte del virus usare in un vaccino? • Che via di somministrazione usare? • Che adiuvante usare? • Pochi investimenti dell’industria farmaceutica

    16. ADIUVANTE + ALUM + citochina

    17. Problemi per lo sviluppo di un vaccino contro HIV/AIDS • Diversi sottotipi di virus • Il virus muta • Mancanza di modelli animali • Quali risposte immuni sono protettive? • Quale parte del virus usare in un vaccino? • Che via di somministrazione usare? • Che adiuvante usare? • Pochi investimenti dell’industria farmaceutica

    18. Vaccino italiano: perchè Tat? • E’ indispensabile al virus per duplicarsi • Muta poco ed è conservata tra i diversi sottotipi • I soggetti con risposte anti-Tat sviluppano la malattia più tardi

    19. Studi preclinici nel topo MEPVDPRLEPWKHPGSQPKTACTNCYCKKCCFHCQVCFITKALGISYGRK KRRQRRRPPQGSQTHQVSLSKQPTSQSRGDPTGPKE • La vaccinazione con Tat è sicura • La vaccinazione con Tat induce risposte immuni anticorpali GSQTHQVSLSKQPTS TAT 39-50 • La vaccinazione con Tat induce risposte immuni cellulari MEPVDPRLEPWKHPGSQPKT ACTNCYCKKCCFHCQVCFIT KALGIS YG RK KRRQRRR PPQGSQTHQVSLSKQ PTSQSRGDPTGPKE TAT 34-45 VCFITKALGISYGRK MHC-II MHC-I CD4 T cell CTL TCR TCR

    20. Conclusione degli studi preclinici La scimmia trattata con Tat e messa a contatto con il virus, non sviluppa l’infezione!

    21. Sviluppo del vaccino basato sulla proteina Tat • Presentazione del dossier per la sperimentazione sull’uomo • Fase I: sicurezza • Fase II: sicurezza e immunogenicità • Fase III: sicurezza, immunogenicità e efficacia

    22. FASE I SULL’UOMO VACCINO PREVENTIVO Protocol Number: ISS-P001 VACCINO TERAPEUTICO Protocol Number : ISS-T001

    23. FASE II VACCINO TERAPEUTICO ATTUALMENTE IN CORSO IN ITALIA VACCINO PREVENTIVO PARTIRA’ IN AFRICA

    24. Vaccini di seconda generazione: vaccini combinati • I vaccini basati su componenti strutturali del virus (Env, Gag) hanno fallito • I vaccini basati su componenti regolatorie (Tat, Nef, Rev) sono sicuri ed immunogenici negli animali e nell’uomo • Vaccini combinati??? +

    25. FP6-EU Commission in Poverty Diseases

    26. AVIP Consortium

    27. Studi preclinici nel topo Risposte immuni dopo vaccinazione con un singolo componente: Env Risposte immuni di vaccini combinati contenenti Tat: Env + Tat +

    28. Risposte immuni contro Env Immunization Positive responses PBS 0 Env 7 Env + Tat 12 Gavioli et al., Vaccine, 2006 Cellini et al. Virol J., 2008 Patent: Vaccines N. PCT/EP2004/011950)

    29. Risposta immune ad un antigene 1. anticorpale 2. cellulare

    30. MHC di classe I MHC di classe II

    31. MHC di classe I MHC di classe II

    32. Peptide binding motif