air kelapa dan santan kelapa n.
Download
Skip this Video
Loading SlideShow in 5 Seconds..
Air Kelapa dan Santan Kelapa PowerPoint Presentation
Download Presentation
Air Kelapa dan Santan Kelapa

Loading in 2 Seconds...

play fullscreen
1 / 21

Air Kelapa dan Santan Kelapa - PowerPoint PPT Presentation


  • 391 Views
  • Uploaded on

Air Kelapa dan Santan Kelapa. Add your company slogan. wideliaikaputri@ub.ac.id. Air Kelapa. Air kelapa muda  langsung dikonsumsi sebagai minuman . Air kelapa tua : Nata de coco Vinegar ( Cuka ) Kecap Diolah menjadi minuman Dll . (Air kelapa segar  steril ).

loader
I am the owner, or an agent authorized to act on behalf of the owner, of the copyrighted work described.
capcha
Download Presentation

PowerPoint Slideshow about 'Air Kelapa dan Santan Kelapa' - hamish-warren


An Image/Link below is provided (as is) to download presentation

Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author.While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server.


- - - - - - - - - - - - - - - - - - - - - - - - - - E N D - - - - - - - - - - - - - - - - - - - - - - - - - -
Presentation Transcript
air kelapa dan santan kelapa

Air KelapadanSantanKelapa

Add your company slogan

wideliaikaputri@ub.ac.id

air kelapa
Air Kelapa
  • Air kelapamuda langsungdikonsumsisebagaiminuman.
  • Air kelapatua :
    • Nata de coco
    • Vinegar (Cuka)
    • Kecap
    • Diolahmenjadiminuman
    • Dll.

(Air kelapasegar steril)

www.themegallery.com

manfaatnya sebagai minuman
Manfaatnyasebagaiminuman
  • Megandungzatgizi sumberkalori
  • Melancarkanurin (Diuretic)
  • Baikbagipenderitatensitinggi
  • Penghilangdahaga

www.themegallery.com

nilai gizi air kelapa db
Nilaigizi air kelapa (%DB)

www.themegallery.com

penelitian khasiat air kelapa
Penelitiankhasiat air kelapa
  • Air kelapadiekstrakdenganetanol.
  • Ekstrakdiujiaktivitasantioksidan-nyasecarain vitro.
  • Ternyataekstraktsbmempunyaiaktivitasantioksidan.
  • Ekstrakdiujisecara in vivo,yaitudiberikankepadatikuspercobaan.

www.themegallery.com

slide6

Ada 2 kelompoktikus (A dan B), keduanyadiberikanminyaktengik yang bisameracuni. Kelompok A diberikanekstrak air kelapa, kelompok B tidakdiberikan (hanyadiberikan air).

  • Setelahbeberapahari, ternyatakelompok B sangatparahkeracunanminyaktengiktsb yang ditandaidenganangka TBA yang tinggi, sedangkanKelompok A tidaktinggiangka TBA nya (Tdkkeracunan).
  • Ekstrak air kelapa khasiatantioksidatif.

www.themegallery.com

kesimpulan penelitian
Kesimpulanpenelitian
  • Air kelapa bergizi
  • Fungsional  berkhasiat

(sumberantioksidan)

www.themegallery.com

santan kelapa coconut milk
SantanKelapa (Coconut Milk)
  • Produksi
    • Pengaruhtingkatketuaan (maturity)
    • Pengaruhukuranpartikeldantekananekstraksi
    • Pengaruhsuhudanrasio air : dagingkelapa
    • Pengaruhpenyimpananbekudanpemanasandagingkelapaygdibekukan

www.themegallery.com

slide9

Struktursantan

    • Agensiapengemulsidalamsantan
    • Komposisidansifatfisikokimia

www.themegallery.com

deskripsi
Deskripsi
  • Santanadalahistilah yang digunakanuntukmenunjukcairan yang diperolehdenganekstraksi manual ataumekanikaldagingkelapaparutdenganatautanpapenambahan air.
  • Santan yang diekstraktanpapenambahan air sangatkental (di Philippine disebutkakanggata).
  • Bedanyadengan “coconut cream” ?

www.themegallery.com

slide11

“Coconut milk” adalahcairanmenyerupaisusudiekstraksegardaridagingkelapadenganatautanpapenambahan air, sedangkan “coconut cream” adalahbahanmenyerupaicreamdengankandunganlemaktinggidiperolehdarisantandengancarapemisahangravitasiatausentrifugasi.

  • Di duniaperdaganganadaistilah lain, “cream of coconut” yaituproduksantan yang dimaniskan, sedangkan “cream coconut” kelapakering yang digiling.
  • Santanmerupakanbagianpentingdarimasakansehari-haridinegara-negarapenghasilkelapa.

www.themegallery.com

slide12

Karena

    • Citarasagurih
    • Nilaigizi
  • Untukberbagaimacam ingredient / ditambahkandalammasakan.
  • Pemanfaatan:
    • Dikonsumsidomestik
    • Diperdagangkandalambentuksantankalengandanbentukkering.
  • (Estimasikonsumsi Indonesia 6,5-8,2 kg/kapita/th.)

www.themegallery.com

pengolahan
Pengolahan
  • Pengolahansantandilakukandenganekstraksidarikelapaparutdenganatautanpapenambahan air.
  • Disebutmetodebasah.
  • Perludiperhatikansupayadapatmemanfaatkansemaksimalmungkinkelapauntukpangan, yaitumenghasilkanproduk-produksantan, air, danampas yang layakdikonsumsi.

www.themegallery.com

slide14

Santanbiasanyadiproduksidaribuahkelapaumur 12 bulan.

  • Padaumurinidagingkelapatebaldankeras, dengankomposisikuranglebih 50% air, 34% minyak, 3.5% protein 3.0% serat, 2.2% abu, dan 7.3% karbohidrat.
  • Secaratradisionalsantandibuatdirumahtanggadenganpenambahan air padaparutankelapa, dipress/ diperasdandisaringdengankainsaring.
  • Alatparutnyasederhana
  • Prosesekstraksisantanscrtradisional

www.themegallery.com

slide15

Pemanfaatansantan

    • Sbg ingredient dalammasakan.
    • Dipanaskanuntukmenghasilkanminyak (minyakklentik/ krengsengan)
  • Dengancarakrengsenganinidapatmengekstrakminyak 70%. Protein-nyadapatdiperolehsebagaiblondo.
  • Kelemahancaraini: tidakefisiendanterdapatkehilanganbahan.
  • Ampas (di Philippine disebutsapal) dengankadar air 47% masihmengandungminyak 25-28% (atau 40%DB).

www.themegallery.com

slide16

Di sampingdipengaruhiteknologipengolahannya, hasilsantandipengaruhioleh:

    • Jenis (varietas) kelapa
    • Tingkat ketuaan
    • Ukuranpartikeldagingkelapa
    • Suhupengolahan
    • Rasioair:kelapaparut
    • Tekananekstraksi.

www.themegallery.com

slide17

Pengaruhtingkatketuaankelapa:

  • Tingkat ketuaankelapasangatberpengaruhterhadaphasilsantan.
  • Kelapatuadenganwarnasabutcoklatdanbelumtumbuh tunas memberikanhasil (yield) santanterbanyak.

www.themegallery.com

satuhu dan sunarmani 2004
(SatuhudanSunarmani, 2004)

www.themegallery.com

slide19

Pengawetansantan

    • Pengalengan (Canning)
    • Opsiteknologi/ rekomendasiuntukproduksisantankalengan
    • Santankering (Dehydrated coc. milk)
    • Pengawetansantansebagaikonsentratgula

www.themegallery.com

slide20

THANK TO MR. UMAR SANTOSO

www.themegallery.com

slide21

Thank You !

www.themegallery.com