slide1 n.
Download
Skip this Video
Loading SlideShow in 5 Seconds..
Hospitals push green building standards By Erik Siemers Business Journal Staff Writer PowerPoint Presentation
Download Presentation
Hospitals push green building standards By Erik Siemers Business Journal Staff Writer

Loading in 2 Seconds...

play fullscreen
1 / 96

Hospitals push green building standards By Erik Siemers Business Journal Staff Writer - PowerPoint PPT Presentation


  • 461 Views
  • Uploaded on

Hospitals push green building standards By Erik Siemers Business Journal Staff Writer. Kaiser Permanente is designing its new $360 million westside hospital complex to meet some of the world’s strictest environmental standards.

loader
I am the owner, or an agent authorized to act on behalf of the owner, of the copyrighted work described.
capcha
Download Presentation

Hospitals push green building standards By Erik Siemers Business Journal Staff Writer


An Image/Link below is provided (as is) to download presentation

Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author.While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server.


- - - - - - - - - - - - - - - - - - - - - - - - - - E N D - - - - - - - - - - - - - - - - - - - - - - - - - -
    Presentation Transcript
    1. Hospitals push green building standards By Erik Siemers Business Journal Staff Writer Kaiser Permanente is designing its new $360 million westside hospital complex to meet some of the world’s strictest environmental standards. Officials with the health care system believe the Kaiser Westside Medical Center in Tanasbourne will qualify for LEED Gold status, making it one of just 36 health care facilities in the world to earn that designation. "That's no small undertaking," said Susan Mullaney, chief administrator of Kaiser's Sunnyside Medical Center in Clackamas who is overseeing the westside project. "We felt it was the important thing to do." LEED — an acronym for Leadership in Energy and Environmental Design — is a system of sustainable design administered by the U.S. Green Building Council. While LEED-certified buildings are becoming more common, few hospitals have been designed to meet the standard. Worldwide, just 128 health care projects are LEED certified, and only 36 of those have met the LEED gold standard that Kaiser expects to reach, said Ashley Katz, a spokeswoman for the U.S. Green Building Council in Washington, D.C. The problematic issue is that hospitals never close. "We're energy intensive and 24/7," said Dan Green, a Kaiser project director overseeing the environmental aspects of the Tanasbourne development. The dearth of LEED hospitals could come to an end starting early next year when the U.S. Green Building Council expects to release a new LEED standard specific to health care facilities. Under the LEED system, buildings are awarded points divided among categories such as sustainable site selection, water efficiency, material sourcing, and energy use. While that won’t change under the LEED health care standard, certain categories will receive more emphasis than others. Sumber: http://www.sustainablebusinessoregon.com/articles/2010/11/hospitals-push-green-building-standards.html ….. Diunduh 6/4/2012

    2. Hospitals push green building standards By Erik Siemers Business Journal Staff Writer The new standard is designed to account for a hospital’s round-the-clock operation, its distinct water needs and a host of other health care-specific functions. "If you have a bank building only open during the day hours vs. a hospital open around the clock, it's different energy use, water use, infection control requirements, those are all different," said Kumkum M. Dilwali, senior director of the Green Guide for Health Care, a sustainable design toolkit for the health care sector that serves as the foundation for the new LEED standard. "You can't hold hospitals to the same standard." The new Kaiser hospital, however, is being built to meet the current LEED standard for new construction. The combined project, including the hospital and adjacent eight-level parking structure, will use high-efficiency water boilers and heating, ventilation and air conditioning units. It will use nontoxic carpet, paint and rubber flooring and building materials free of dioxins, lead, cadmium and mercury. Its insulation will be made from recycled denim. It will generate on-site renewable power from solar panels, utilize occupancy sensors in certain areas to preserve electricity and use windows designed to provided natural lighting. The development will provide easy access to public transit, offer electric charging stations and priority parking for low-emissions vehicles, and will set aside a designated area for a farmers market. LEED The Leadership in Energy and Environmental Design (LEED) Green Building Rating System® encourages and accelerates global adoption of sustainable green building and development practices through the creation and implementation of universally understood and accepted tools and performance criteria. LEED is a third-party certification program and an internationally accepted benchmark for the design, construction and operation of high performance green buildings. It provides building owners and operators the tools they need to have an immediate and measurable impact on their buildings’ performance. LEED promotes a whole-building approach to sustainability by recognizing performance in five key areas of human and environmental health: sustainable site development water efficiency energy efficiency materials selection indoor environmental quality Sumber: http://www.sustainablebusinessoregon.com/articles/2010/11/hospitals-push-green-building-standards.html ….. Diunduh 6/4/2012

    3. THE GREEN HEALTH CARE The Green Health Care help the leaders and managers of health care institutions, promoting the health of patients, visitors, employees, community members, and the global community, while operating economically and efficiently. Hope that every medical center, hospital and clinic in the nation gets a knowledge of the Green concept, takes its lessons to heart, and joins the growing movement toward healthier, more environmentally friendly environments in the health care sector. (Howard Frumkin). Green health care is likely to be most compelling because of its potential to protect and promote health, both directly and indirectly. These health benefits may operate on at least three scales: local, community, and global. On the local scale, within the walls of a hospital, research facility, or clinic, green construction and operation can protect patients, workers, and visitors. Global warming has become the most important environmental issue due to its detrimental health effects. Institutional comprehension and involvement which may minimize its detrimental effects is considered insufficient. Based on recent data, there are lot of health care facilities in Indonesia which need the policy to apply the Green concept into management. There is a large and growing body of evidence demonstrating the role of the physical environment in achieving health care quality and safety. For example, associations between the physical environment and patient and staff outcomes in four areas: reduced staff stress and fatigue and increased effectiveness in delivering care; improved patient safety; reduced patient stress and improved health outcomes; and improved overall healthcare quality. Sumber: http://www.depkes.go.id/downloads/seminar_rs_persahabatan.pdf ….. Diunduh 6/4/2012

    4. The Green Hospital: from centres of sickness to centres of wellness.(Sources: In part – recycled from Planet Green) Graeme Booth 02 01 2012 Recycling:We all should recycle, but hospitals even more so that others! Hospitalswith an environmental bent are recycling alcohol, batteries, lightbulbs, old linens, computers, paper, cardboard, packing peanuts andmore. They are also saving kitchen oil for bio-diesel processing. Reusing Materials:  Hospitals should make a concerted effort to reuse packing materials,wheelchairs and crutches, envelopes for internal communication, andmedical equipment. I used crutches when I tore my ACL ? the hospitalnever asked for them back, or told me about a recycling opportunity.I'd gladly give them in, rather than keeping them in my closet,taking up space. Reducing Waste: It isn't enough to recycle and reuse. After all, it is 2008, and thebasics aren't good enough! Hospitals must also rethink the types ofproducts they purchase. Green hospitals are using energy efficientlight bulbs and reusable silverware. Some are even composting andusing cloth nappies/diapers. Cleaner Air: Going green also means better air quality. To that end, somehospitals are installing systems that provide better ventilation.They are also using cleaning materials with fewer hazardous materialsand paints with fewer VOCs. And to reduce pollution outdoors, someoffer electric car charging stations.. Sumber: http://pt.wiserearth.org/forum/view/e4a444c778f8f37c9b71687a4175fb62 ….. Diunduh 6/4/2012

    5. Using Plants as an Alternative to Air Purifiers Posted on June 3, 2011 How to Use House Plants as Air Purifiers in the Home Expanded concept, further criteria for the creation of the truly "Green Hospital" The green hospital movement is a positive development towards sustainable medical institutions. But to succeed with such an ambition, the green-hospital concept needs to be broadened. The following criteria need to be explored: living-systems design. equitable work-places, socially just/ democratic legitimacy, -the transition to alternative medical and therapeutic practices. Energy autonomous buildings Economising of water use, including the collection and reuse of rain and snow. Ecologically sustainable materials. Ecological and locally produced food. Renewable and energy efficient hospital operation Incorporating natural, - light design, material use in furnishing and décor. The greening of interiors (indoor-planting) and landscaping (with high indoor visibility) around the hospital. Houseplants Do Purify the AirThe effectiveness of using green plants for this purpose has even been documented by independent studies conducted by NASA officials. The simple use of houseplants can remove carbon dioxide, ammonia fumes, benzene and even eliminate formaldehyde odors from an enclosed environment. You can refresh the air in a home, garage or other enclosed environment by placing a few green plants on shelves or on the floor. Hanging some plants from the ceiling is another option to consider. How Plants Filter and Clean Indoor AirThe leaves, roots and stems of a green plant can serve as air filters. Polluting odors, toxic substances and other contaminating agents can be absorbed into the plant and in return the plant will release clean oxygen into the air. Many people have found that common allergies and breathing ailments are reduced or even resolved once a few green plants are placed in the home. Making Space for Air Purifying PlantsIt really does not require a lot of extra room for the placement of some houseplants. You can arrange a few plants on a desk, coffee table, kitchen window sill or set them on a shelf. Larger plants can be put into attractive containers and placed in a corner of the room where they will even add visual impact along with those air purifying benefits. Any room can house at least one or two green plants. You should consider placing some plants in the bedrooms, family room, kitchen and workshop. These are all rooms that are prone to the highest amount of toxins and pollutants. Sumber: http://www.easywaystogogreen.com/green-homes/using-plants-as-an-alternative-to-air-purifiers/ ….. Diunduh 6/4/2012

    6. KRITERIA LANJUT GREEN HOSPITAL Another area in the hospitals transition to that of becoming in my mind truly green, must be the adoption and incorporation of alternative diagnosis, therapies and medicine into standard hospital practice. To be truly green requires a shift from treatments that are chiefly pharmaceutically based, destructive to the environment, with benefitsthat are short-term, focused on symptom suppression, to that ofwhole-person diagnosis and treatments, strengthening and aiding theindividuals own capacity for healing. Placing a larger emphasis on and parallel to the treatment of 'sickness' should be prevention-consultation, with a focus on lifestyle, stress and the environmentally-related, negative side-effects that occur to thepsychic/somatic functions of the individual. With the introduction of alternative therapies into hospitals, structural changes would have to follow. One change that I deem advantageous and even necessary would be the introduction of the roll of diagnostic-guide for patients. His/her roll (a jack of all therapies) would be to assess through certain initial verbal analysis and diagnosis, the patients situation and needs, be they in need of acute, chronic or prevention orientated treatments, and guiding said patient to departments within the “traditional” or the many different alternative treatments. Sumber: ….. Diunduh 6/4/2012

    7. GREEN HOSPITAL --- SOCIAL CHANGE . The green hospital that is seriously engaged in helping individual patients and catering fully to their possibility for recovery and future wellness, needs even to empower each and everyone of it's co-workers/ practitioners. The function and development of the green hospital must be determined by it's members/staff. Every hospital would develop from the unique combination and gestation of its practitioners/co-workers, community-interdependence and vision. This would call for a foundation of not-for-profit enterprise, an enterprise based on respect, the democratic workplace, individual engagement and responsibility. Cooperation, equality and the possibility for all to learn and grow would need to be a priority. Close interaction and a supportive relationship with the local community would create new possibilities for both. The exploring of new funding and financing systems that would allow all citizens access to help irrespective of their financial situation. The right to help for all who seek a healthier and higher quality of life.] I envisage the new green hospitals as centres for healing and wellness. A part of that roll would be research, inform and educate the community on the multi-faceted area of life-quality from a whole-person perspective. TANAMAN DALAM RUANGAN YANG MEMBERSIHKAN UDARA Anthuriums make lovely gifts because of their exotic-looking blooms, but they ain’t just a pretty face! Their large, dark leaves suck up ammonia, formaldehyde, toluene and xylene, so they’re a thoughtful present for a workplace (especially around copiers, printers or adhesives). Sumber: http://inhabitat.com/7-indoor-plants-that-purify-the-air-around-you-naturally/2/….. Diunduh 6/4/2012

    8. Analisis Kenyamanan Spasial Di Ruang Publik Rumah Sakit Untuk Ibu Hamil Putri, Natalia Gunawan (0663042) (2006) Analisis Kenyamanan Spasial Di Ruang Publik Rumah Sakit Untuk Ibu Hamil. Thesis, Universitas Kristen Maranatha. Rumah sakit pada dasarnya merupakan sebuah institusi pelayanan yang bergerak di bidang kesehatan. Citra dari rumah sakit terlihat dari cara pelayanan dan fasilitas yang tersedia, terutama pada ruang tunggu. Ruang tunggu yang baik harus bisa menghindarkan pasien dari stres dan dapat memberi pengaruh positif bagi pasien. Sekarang ini masih banyak ruang tunggu yang tidak memperhatikan beberapa hal yang berhubungan dengan kenyamanan terutama kenyamanan spasial. Kenyamanan spasial merupakan kenyamanan antara pengguna itu sendiri yang berhubungan dengan aktifitas dan skala dalam ruang, termasuk ukuran. Penelitian ini membahas kenyamanan spasial ruang tunggu khusus ibu hamil yang mempunyai kondisi fisik dan psikologis berbeda dengan kondisi orang sakit atau pasien biasa dengan studi kasus adalah area ruang tunggu rumah sakit yang tidak didesain khusus untuk ibu hamil yaitu Rumah Sakit Immanuel dan area ruang tunggu rumah sakit yang didesain khusus untuk ibu hamil yaitu rumah sakit bersalin Melinda Hospital. Eco-House Decoration Ideas Using Garden Plants as Air Filters Simultaneously Whether you are planning adorn the pergola, gazebo or gate with your garden plants? Do not hesitate to launch garden plants design concept for the house has many environmentally friendly and healthier profits. Aside from being a decoration, plants are also useful to filter the dust around the house. If observed, the plants in front of the house must be appropriate leaves coated with dust. Plants also produce oxygen that is also very useful for our breathing. (sumber: http://homedesign2you.com/eco-house-decoration-ideas-using-garden-plants-as-air-filters-simultaneously) Sumber: http://repository.maranatha.edu/776/ ….. Diunduh 6/4/2012

    9. PELAYANAN UMUM = PELAYANAN PUBLIK Pelayanan publik atau pelayanan umum dapat didefinisikan sebagai segala bentuk jasa pelayanan, baik dalam bentuk barang publik maupun jasa publik yang pada prinsipnya menjadi tanggung jawab dan dilaksanakan oleh Instansi Pemerintah di Pusat, di Daerah, dan di lingkungan Badan Usaha Milik Negara atau Badan Usaha Milik Daerah, dalam rangka upaya pemenuhan kebutuhan masyarakat maupun dalam rangka pelaksanaan ketentuan peraturan perundang-undangan. • Berdasarkan organisasi yang menyelenggarakannya, pelayanan publik atau pelayanan umum dapat dibedakan menjadi dua, yaitu: • Pelayanan publik atau pelayanan umum yang diselenggarakan oleh organisasi privat, adalah semua penyediaan barang atau jasa publik yang diselenggarakan oleh swasta, seperti misalnya rumah sakit swasta, PTS, perusahaan pengangkutan milik swasta. • Pelayanan publik atau pelayanan umum yang diselenggarakan oleh organisasi publik. Hal ini dapat dibedakan lagi menjadi : • Yang bersifat primer dan,adalah semua penye¬diaan barang/jasa publik yang diselenggarakan oleh pemerintah yang di dalamnya pemerintah merupakan satu-satunya penyelenggara dan pengguna/klien mau tidak mau harus memanfaatkannya. Misalnya adalah pelayanan di kantor imigrasi, pelayanan penjara dan pelayanan perizinan. • Yang bersifat sekunder, adalah segala bentuk penyediaan barang/jasa publik yang diselenggarakan oleh pemerintah, tetapi yang di dalamnya pengguna/klien tidak harus mempergunakannya karena adanya beberapa penyelenggara pelayanan. Sumber: http://id.wikipedia.org/wiki/Pelayanan_publik….. Diunduh 6/4/2012

    10. PENGERTIAN PELAYANAN PUBLIK Pelayanan publik merupakan kegiatan atau rangkaian kegiatan dalam rangka pemenuhan kebutuhan pelayanan sesuai dengan peraturan perundang-undangan bagi setiap warga negara dan penduduk atas barang, jasa, dan/atau pelayanan administratif yang disediakan oleh penyelenggara pelayanan publik, Penyelenggara pelayanan publik atau Penyelenggara merupakan setiap institusi penyelenggara negara, korporasi, lembaga independen yang dibentuk berdasarkan undang-undang untuk kegiatan pelayanan publik, dan badan hukum lain yang dibentuk semata-mata untuk kegiatan pelayanan publik, Atasan satuan kerja Penyelenggara merupakan pimpinan satuan kerja yang membawahi secara langsung satu atau lebih satuan kerja yang melaksanakan pelayanan publik, Organisasi penyelenggara pelayanan publik atau Organisasi Penyelenggara merupakan satuan kerja penyelenggara pelayanan publik yang berada di lingkungan institusi penyelenggara negara, korporasi, lembaga independen yang dibentuk berdasarkan undang-undang untuk kegiatan pelayanan publik, dan badan hukum lain yang dibentuk semata-mata untuk kegiatan pelayanan publik, Pelaksana pelayanan publik atau Pelaksana merupakan pejabat, pegawai, petugas, dan setiap orang yang bekerja di dalam Organisasi Penyelenggara yang bertugas melaksanakan tindakan atau serangkaian tindakan pelayanan publik, Masyarakat merupakan seluruh pihak, baik warga negara maupun penduduk sebagai orang-perseorangan, kelompok, maupun badan hukum yang berkedudukan sebagai penerima manfaat pelayanan publik, baik secara langsung maupun tidak langsung, Standar pelayanan merupakan tolak ukur yang dipergunakan sebagai pedoman penyelenggaraan pelayanan dan acuan penilaian kualitas pelayanan sebagai kewajiban dan janji Penyelenggara kepada masyarakat dalam rangka pelayanan yang berkualitas, cepat, mudah, terjangkau, dan terukur. Maklumat pelayanan merupakan pernyataan tertulis yang berisi keseluruhan rincian kewajiban dan janji yang terdapat dalam standar pelayanan. Sistem informasi pelayanan publik atau Sistem Informasi merupakan rangkaian kegiatan yang meliputi penyimpanan dan pengelolaan informasi serta mekanisme penyampaian informasi dari Penyelenggara kepada masyarakat dan sebaliknya dalam bentuk lisan, tulisan Latin, tulisan dalam huruf Braile, bahasa gambar, dan/atau bahasa lokal, serta disajikan secara manual ataupun elektronik. Mediasi merupakan penyelesaian sengketa pelayanan publik antarpara pihak melalui bantuan, baik oleh ombudsman sendiri maupun melalui mediator yang dibentuk oleh ombudsman. Ajudikasi merupakan proses penyelesaian sengketa pelayanan publik antarpara pihak yang diputus oleh ombudsman.

    11. KARAKTERISTIK LAYANAN PUBLIK Ada lima karakteristik yang dapatdipakaiuntukmembedakanketigajenispenyelenggaraanpelayananpubliktersebut, yaitu: Adaptabilitaslayanan. Iniberartiderajatperubahanlayanansesuaidengantuntutanperubahan yang dimintaolehpengguna. Posisitawarpengguna/klien. Semakintinggiposisitawarpengguna/klien, makaakansemakintinggi pula peluangpenggunauntukmemintapelayanan yang lebihbaik. Type pasar. Karakteristikinimenggambarkanjumlahpenyelenggarapelayanan yang ada, danhubungannyadenganpengguna/klien. Locus kontrol. Karakteristikinimenjelaskansiapa yang memegangkontrolatastransaksi, apakahpenggunaataukahpenyelenggarapelayanan. Sifatpelayanan. Hal inimenunjukkankepentinganpenggunaataupenyelenggarapelayanan yang lebihdominan. Undang-Undang Pelayanan Publik (secara resmi bernama Undang-Undang Nomor 25 Tahun 2009 tentang Pelayanan Publik) adalah undang-undang yang mengatur tentang prinsip-prinsip pemerintahan yang baik yang merupakan efektifitas fungsi-fungsi pemerintahan itu sendiri. perlayanan publik yang dilakukan oleh pemerintahan atau koporasi yang efektif dapat memperkuat demokrasi dan hak asasi manusia, mempromosikan kemakmuran ekonomi, kohesi sosial, mengurangi kemiskinan, meningkatkan perlindungan lingkungan, bijak dalam pemanfaatan sumber daya alam, memperdalam kepercayaan pada pemerintahan dan administrasi publik. Sumber: http://id.wikipedia.org/wiki/Pelayanan_publik ….. Diunduh 6/4/2012

    12. . Pengaruh Desain Pencahayaan Terhadap Kenyamanan Dan Pembentukkan Suasana Pada Koridor Dan Ruang Tunggu Rumah Sakit Gallery Hendrawan, Jeremia (0663173) (2006) Pengaruh Desain Pencahayaan Terhadap Kenyamanan Dan Pembentukkan Suasana Pada Koridor Dan Ruang Tunggu Rumah Sakit Gallery. Other thesis, Universitas Kristen Maranatha. Melinda Hospital adalah rumah sakit bersalin dengan konsep mix-use (koridor gallery) yang terdapat di kota Bandung. Menurut hasil kuesioner, Melinda Hospital merupakan rumah sakit yang memiliki suasana paling menarik dibandingkan dengan rumah sakit lain yang ada di Bandung. Melinda Hospital memakai gaya modern tradisional dalam mendesain interior dan eksterior bangunannya. Dengan memakai konsep fungsi mix-use, Melinda Hospital membuat terobosan baru dalam perancangan desain rumah sakit di Indonesia, terutama di Bandung. Jika melihat pada masa sebelumnya, koridor rumah sakit merupakan suatu tempat ataupun ruang yang berkesan menyeramkan. Dengan suasana yang gelap, kotor, dan sempit, membuat koridor dianggap ruang yang angker pada bagian rumah sakit. Melinda Hospital membuat konsep yang berbeda dengan rumah sakit sebelumnya, dengan memasukkan fungsi mix-use dengan gaya modern, sehingga membuat masyarakat dapat merubah pola pikirnya mengenai koridor rumah sakit. Dengan teknik pencahayaan buatannya yang memasang lampu hanya pada bagian pinggir tembok, Melinda Hospital memberikan kesan yang berbeda pada koridor dan ruang tunggunya. Tetapi jika diteliti, terdapat beberapa kekurangan dari penyeimbangan fungsi mix-use yang dipakainya. Karena itu penulis melakukan penelitian mengenai pengaruh desain pencahayaan terhadap kenyamanan dan pembentukkan suasana pada koridor dan ruang tunggu rumah sakit gallery dengan objek studi Melinda Hospital. Penelitian ini dilakukan melalui dua metode yaitu kuantitatif dan kualitatif. Penelitian dengan metode kualitatif dilakukan melalui wawancara tak terstruktur dengan pengelola rumah sakit dan pengunjung, dan membandingkan objek studi dengan teori yang ada. Penelitian kuantitatif dilakukan melalui pengukuran kuat cahaya dengan menggunakan lux meter, penghitungan jumlah titik lampu dengan metode DPMB, menghitung penyebaran cahaya dengan perangkat lunak Dialux, dan penyebaran kuesioner. Hasil penelitian menunjukkan bahwa Melinda Hospital memiliki kekurangan pencahayaan pada koridor dan ruang tunggu gallerynya. Dari pengukuran kuat cahaya pun terdapat kekurangan pada Melinda Hospital jika dibandingkan dengan standar lux yang ada. Setelah melakukan penelitian di Melinda Hospital, pencahayaan yang ada tidak dapat menunjang fungsi mix-use yang selama ini dipakai, baik itu dari sisi jenis lampu yang dipakai, kuat cahaya yang ada, dan jumlah lampunya. Namun para pengunjung Melinda Hospital dapat merasakan suatu suasana yang berbeda dari rumah sakit lain yang ada di Bandung, karena Melinda Hospital telah mendesain interiornya sedemikian rupa, baik itu dari sisi pemilihan warna, material, desain bentukan, dan bukaan-bukaan yang dibuatnya. Sumber: http://repository.maranatha.edu/824/ ….. Diunduh 6/4/2012

    13. Mengukur Kenyamanan Bangunan Berdasarkan Kondisi Tubuh dan Suhu Rumah yang ideal merupakan rumah yang dapat memberikan kenyamanan bagi penghuninya. Kenyamanan yang Anda dan keluarga rasakan tentunya berimbas pada kondisi tubuh dan suhunya. Selain itu bisa juga kenyamanan rumah berdampak pada mood Anda melakukan aktivitas apapun di rumah, contohnya membaca buku, memasak, dan bersantai di rumah. Dengan demikian rumah memiliki efek psikologis bagi penghuninya.Kondisi tubuh akan dengan mudah merespon atmosfer keadaan rumah, jika rumah tersebut bersih dan wangi maka akan memberikan respon yang positif bagi tubuh Anda. Anda akan merasakan kenyamanan di rumah yang seperti itu. Kondisi tubuh akan berada pada titik ketenangan menikmati suasana rumah yang teratur rapi dan sejuk. Demikian pula dengan suhu tubuh akan berjalan stabil karena berada pada kondisi ruangan rumah yang memberikan sugesti yang menyejukkan pikiran dan hati apalagi jika rumah Anda dihiasi dengan desain interior yang indah dan menawan pasti Anda dan keluarga akan betah tinggal di sana terlebih lagi tamu-tamu yang berkunjung akan merasa nyaman sekali bertamu ke rumah Anda. Dengan demikian, indikator kenyamanan sebuah rumah dapat diukur dari kondisi dan suhu tubuh para penghuninya. Secara biologis, tubuh manusia mempunyai tingkat adaptasi dan respon terhadap lingkungan sekitarnya, maka kondisi tubuh dengan suhu manusia akan berbanding seimbang dengan keadaan lingkungannya termasuk rumah. Berbeda halnya jika rumah kurang terawat dan sangat berantakan, maka kenyamanan pun akan hilang. Anda mungkin akan segera keluar dari kondisi rumah yang seperti itu. Dengan rumah yang tidak sehat maka kondisi tubuh pun akan rentan terhadap penyakit dan suhu tubuh akan tidak normal, misalnya demam yang tinggi, atau malah dingin yang sangat menggigil. Rumah seperti itu dipastikan karena kurangnya fasilitas sanitasi sehingga menimbulkan rumah yang kumuh dan sirkulasi udara tidak lancar. Ditambah pengadaan air bersih yang kurang akan mengakibatkan kesehatan tubuh memburuk. Setelah melihat perbandingan di atas, maka kenyamanan bangunan dapat diindikasikan dari tata letak ruangan yang akan menghasilkan kerapihan, dan sanitasi serta sirkulasi yang membuat kesehatan penghuni terjaga. Dengan struktur bangunan yang rapi dan bersih, maka akan menstabilkan kondisi dan suhu tubuh. Sumber: http://www.imagebali.net/detail-artikel/263-mengukur-kenyamanan-bangunan-berdasarkan-kondisi-tubuh-dan-suhu.php….. Diunduh 6/4/2012

    14. Mengukur Kenyamanan Bangunan Berdasarkan Kondisi Tubuh dan Suhu Sirkulasi udara yang lancar melalui ventilasi ruangan yang cukup akan menciptakan kondisi sejuk di dalam ruangan tanpa harus menggunakan air conditioner (AC) dan pencahayaan dari matahari yang masuk ke dalam bangunan membuat kondisi ruangan terang dan tidak lembab. Itulah salah satu yang membuat rumah menjadi nyaman, yakni dari tata ruang dan letak bangunan. Maka tidak ada salahnya jika Anda menghubungi arsitektur untuk mewujudkan bangunan yang nyaman. Berdasarkan kondisi lingkungan tempat bangunan Anda akan berdiri, pihak arsitektur bisa merancang bangunan seperti apa yang cocok dan nyaman bagi Anda dan keluarga, di samping Anda pun punya rancangan sendiri yang nantinya dikolaborasikan dengan ketentuan-ketentuan arsitektur sehingga tercipta bangunan yang memberikan kenyamanan bagi Anda. Jika bangunan rumah Anda sudah ada tetapi Anda kurang merasa nyaman tinggal di dalamnya berdasarkan kondisi tubuh dan suhu Anda dan keluarga yang sangat rentan sakit, seperti flu, pusing, dan gangguan pencernaan semacam dia. Maka Anda harus melakukan tata letak dan ruang ulang yang benar melalui renovasi kecil misalnya membuat ventilasi udara yang cukup bagi ukuran ruangan rumah Anda, ingatlah prinsip renovasi yang mengutamakan asas prioritas jadi jangan merenovasi bagian rumah yang dipAndang tidak terlalu penting untuk dirombak. Akan tetapi jika finansial belum memungkinkan Anda melakukan renovasi, jalan lain yang sebenarnya tidak mengeluarkan biaya adalah Anda melakukan perawatan dan menjaga kebersihan banguanan rumah Anda. Dengan membersihkan rumah seperti menyapu dan mengepel lantai memakai pewangi, membuka jendela setiap pagi, merapikan barang-barang, menguras bak, dan rajin membuang sampah ke tempat penampungan sampah di luar rumah setiap hari agar sampah tidak menumpuk di dalam rumah dan udara menjadi segar. Kenyamanan bangunan tidak diukur diukur dari kemewahan rumah, tetapi dari perawatan lanjutan setelah mempunyai rumah yang membuat kondisi dan suhu tubuh Anda dan keluarga stabil. Sumber: http://www.imagebali.net/detail-artikel/263-mengukur-kenyamanan-bangunan-berdasarkan-kondisi-tubuh-dan-suhu.php….. Diunduh 6/4/2012

    15. Konsep Green Architecture / Arsitektur Hijau Secara Umum . Konsep green architecture atauarsitekturhijausaatinimenjaditopik yang ramaidiperbincangkan, selainkesadaranmasyarakat yang makintinggiakanpentingnyamelestarikanalamhalinijugauntukmenghematsumberdayaalam yang takterbarukan. Berbagaipemikirantentanggreen arsitektur pun bermunculanseiringpersaingandiduniaarsitek. Green architecture ialahsebuahkonseparsitektur yang berusahameminimalkanpengaruhburukterhadaplingkunganalammaupunmanusiadanmenghasilkantempathidup yang lebihbaikdanlebihsehat, yang dilakukandengancaramemanfaatkansumberenergidansumberdayaalamsecaraefisien. Konseparsitekturinipadadasarnyalebihbertanggungjawabterhadaplingkungansekitar, penggunaanbahandaurulangdanjugaramahlingkungan. Green architecture  diharapkanakandigunakandimasakinidanmasa yang akandatang, demikelangsunganhidup yang lebihbaik, dibawahinibeberapaprinsipdari green architecture : Hematenergi, Pengoperasianbangunanmeminimalkanpenggunaanbahan baker danenergilistrik. Memperhatikankondisiiklim, mendesainbangunanharusdisesuaikandengankondisiiklimsetempat. Meminimalkanpemakaiansumberdayabaru, sepertimenggunakanbahandaurulangataupenggunaan material bangunan yang tidakberbahayabagiekosistemdansumberdayaalam. Tidakberdampak negative bagikesehatandankenyamananpenghunibangunantersebut, bangunan yang akandibuatnantinyatidakmerusakalamsekitarnyasehinggapadasaatbangunantersebutsudahtidakdigunakan, lingkunagnsekitarakantetaptampakaslinya Meresponkeadaantapakdaribangunan, dalammerancangbangunanharusmemperhatikansemuapenggunabangunandanmemenuhisemuakebutuhannya. Menetapkanseluruhprinsip – prinsip green architecture secarakeseluruhan, ketentuandiatastidakbakudankitadapatmenyesuaikannyadengankebutuhan. Green architecture (arsitekturhijau) mulaitumbuhsejalandengankesadarandariparaarsitekakanketerbatasanalamdalammenyuplai material yang mulaimenipis.Alasan lain digunakannyaarsitekturhijauadalahuntukmemaksimalkanpotensialam.Penggunaan material-material yang bisadidaur-ulangjugamendukungkonseparsitekturhijau, sehinggapenggunaan material dapatdihemat. Sumber: http://www.imagebali.net/detail-artikel/159-konsep-green-architecture-arsitektur-hijau-secara-umum.php….. Diunduh 6/4/2012

    16. Konsep Green Architecture / Arsitektur Hijau Secara Umum Green dapat diinterpretasikan sebagai sustainable (berkelanjutan), earthfriendly (ramah lingkungan), dan high performance building (bangunan dengan performa sangat baik).A.Sustainable ( Berkelanjutan ). Yang berarti bangunan green architecture tetap bertahan dan berfungsi seiring zaman, konsisten terhadap konsepnya yang menyatu dengan alam tanpa adanya perubahan – perubuhan yang signifikan tanpa merusak alam sekitar. B. Earthfriendly ( Ramah lingkungan ). Suatu bangunan belum bisa dianggap sebagai bangunan berkonsep green architecture apabila bangunan tersebut tidak bersifat ramah lingkungan, artinya bukan hanya desain tetapi juga dalam implementasinya dalam penggunaan bahan atau material untuk bangunan. C. High performance building. Bangunan yang disebut green arsitektur juga harus memiliki sifat ini, artinya memanfaatkan tenaga alam dengan didukung teknologi tinggi . Contohnya :1.Penggunaan panel surya ( Solar cell ) untuk memanfaatkan energi panas matahari sebagai sumber pembangkit tenaga listrik rumahan.2.Penggunaan material – material yang dapat di daur ulang. Secara sederhana konsep green architecture ini bisa kita terapkan di dalam rancangan rumah sederhana sekalipun, hanya saja semua kembali pada kesadaran diri kita sendiri, apakah ada niat baik untuk menuju ke sana, demi kelangsungan hidup anak cucu kita di masa depan yang lebih baik Sumber: http://www.imagebali.net/detail-artikel/159-konsep-green-architecture-arsitektur-hijau-secara-umum.php….. Diunduh 6/4/2012

    17. Menggunakan Tanaman Gantung Untuk Memperindah Teras . anaman gantung bisa digunakan untuk mempercantik tampilan teras. Selain itu juga bisa dijadikan sebagai alternatif untuk memunculkan suasana sejuk jika tidak punya lahan yang cukup untuk membuat taman. Apalagi tanaman gantug dengan susunan daunnya yang menjuntai ke arah bawah juga bisa dijadikan media untuk mengatur sistem pencahayaan yang masuk ke dalam ruang serta sistem sirkulasi udara. Sehingga bukan hanya mendapat tampilan teras makin cantik, namun suasana sejuk dan segar bisa diperoleh sekaligus. Jenis tanaman gantung yang bisa digunakan atau dipasang diteras ada dua macam yaitu jenis tanaman yang membutuhkan banyak sinar matahari serta tanaman lain yang tidak begitu membutuhkan. Jenis tanaman yang tahan dan butuh banyak sinar matahari ditempatkan di teras secara langsung. Lokasinya berada di bagian pinggir bawah atap atau plafon. Di tempat seperti ini matahari bisa memberikan sinarnya secara langsung kepada tanaman tersebut.Sedangkan untuk jenis tanaman yang tidak tahan dengan sinar matahari bisa diletakan pada ranting atau cabang pohon yang besar. Jika mau menggunakannya untuk mempercantik tampilan teras alat yang digunakan untuk menanam adalah pot tempel yang dipasang di bagian dinding dalam teras. Jadi tanaman tidak tidak akan terkena sinar matahari secara langsung. Jenis pot untuk tempat tanaman juga bermacam-macam terutama dari bahan yang digunakan. Ada yang terbuat dari plastik, keramik, tanah liat, besi dan kayu. Masing-masing punya kelebihan dan kekurangan tersendiri. Untuk yang menggunakan plastik, kelebihannya adalah bahan tersebut ringan, awet dan mudah dibersihkan. Pada umumnya warna yang digunakan adalah hitam dan merah marun. Kekurangan dari pot jenis ini adalah bentuk desain yang tersedia tidak begitu banyak sehingga kurang dapat menambah nilai estetika. Sedangkan untuk keramik dan tanah liat punya kelebihan banyak desain, model dan bentuk. Bahkan jika kita pergi ke tempat pembuatannya langsung dapat memesan bentuk dan ukuran yang disesuaikan dengan konsep desain rumah atau teras. Demikian pula dengan modelnya. Khusus tanah liat, warnanya juga bisa dipilih sesuka hati dengan menggunakan cat warna. Adapun kelemahan dari kedua bahan ini adalah lebih berat dari plastik dan mudah pecah. Sumber: http://www.imagebali.net/detail-artikel/360-menggunakan-tanaman-gantung-untuk-memperindah-teras.php….. Diunduh 6/4/2012

    18. Menggunakan Tanaman Gantung Untuk Memperindah Teras Untuk kayu dan besi punya kelebihan yang sama dengan bahan tanah liat dan keramik. Adapun kekurangannya adalah untuk kayu mudah keropos dan berjamur sedang untuk besi gampang berkarat. Dua kelemahan ini punya efek yang sama yaitu pot menjadi cepat rusak dan tidak kuat menahan beban tanah yang digunakan sebagai media tanam. Akibatnya tanah bisa ambrol atau jatuh keluar. Bahan untuk tali yang digunakan sebagai gantungan juga ada beberapa macam yaitu kawat, tali plastik, rantai besi dan sebagainya. Khusus untuk yang menggunakan pot besi, keramik dan tanah liat gunakan tali yang ukurannya lebih besar dan kuat sehingga bisa menanggung beban yang berat pula. Sebaiknya tali yang digunakan juga memilih jenis tali yang memang dibuat khusus untuk menempatkan pot gantung. Karena tali seperti ini teknik pembuatannya juga menggunakan desain dan gaya yang menarik. Bukan sekedar di pasangkan pada pot gantung begitu saja. Sehingga tampilan ruang dan tanaman gantung beserta potnya ini bisa makin menarik. Di toko-toko tanaman hias tali gantung seperti ini sudah banyak dijual. Hanging Plants Hanging plants are a smart choice for apartments and generally for small spaces. The idea is that you can bring the green inside it without wasting your apartment space. What can you grow in hanging baskets? You can actually, cultivate any plant adaptable to the atmosphere and low light of an enclosed space such as “Philodendron” , “English Ivy” or “Pothos”. Options are more numerous in case of a bright apartment with an opening to the South. However, you can plant even, vegetables and fruits in these hanging baskets such as “cherry tomatoes” or “strawberries”. On the other hand, if you prefer an exotic atmosphere, consider plants such as “Hoya plants” (http://howtobuildahouseblog.com/?p=11695 ) Sumber: http://www.imagebali.net/detail-artikel/360-menggunakan-tanaman-gantung-untuk-memperindah-teras.php….. Diunduh 6/4/2012

    19. TRIK MEMBUAT TAMAN DI DALAM RUANG . Selain di luar ruang, sebuah taman juga bisa dibuat di dalam ruang untuk menambah keanggunan tampilan ruang tersebut. Selain itu dengan menempatkan taman di dalam ruang akan membuat penghuni rumah akan merasa satu dengan alam.Untuk membuat taman di dalam ruang, pertama kali yang harus dilakukan adalah mencari lokasi yang cocok. Pilihlah lokasi yang bisa terkena sinar matahari secara langsung. Sehingga meski berada di dalam ruang, kebutuhan sinar tanaman bisa tetap terpenuhi. Jika sinar yang masuk kedalam ruang tidak maksimal, ketika memilih tanaman pilihlah jenis tanaman yang tidak begitu membutuhkan sinar matahari. Lokasi taman juga perlu memperhitungkan apakah letak taman tesebut benar-benar aman. Maksudnya adalah, pada waktu siang hari tanaman akan menguluarkan zat oksigen yang sangat berguna bagi tubuh. Namun pada malam hari pada umumnya tanaman akan mengeluarkan zat lain yang justru akan membahayakan tubuh. Jadi pilihlah lokasi taman yang tidak begitu dekat dengan tempat istirahat malam terutama ruang tidur. Sirkulasi udara dan kelembaban juga perlu dicermati agar tanaman tidak terlalu kepanasan atau justru terlalu kedinginan. Jika terlalu panas tanaman akan mudah kering dan jika terlalu dingin akan menyebabkan busuk.Untuk pemilihan jenis tanaman, pilihlah jenis tanaman yang lebih mudah beradaptasi dalam segala kondisi dan cuaca. Kemudian untuk media penempatan, yang terbaik tentu saja adalah pot. Karena dengan menggunakan pot perawatan akan lebih mudah dilakukan dan kemungkinan untuk memunculkan kotoran pada lantai juga lebih kecil.  Disarankan pula pada bagian bawah pot tersebut diberi wadah untuk menampung air siraman yang tersisa atau tanah yang larut terkena air siraman. Agar nampak indah pilihlah jenis pot yang sesuai dengan jenis tanaman yang digunakan. Beri juga pewarnaan pada pot tersebut yang diselaraskan dengan nuansa yang ada pada ruangan. Kemudian agar nampak lebih bersih pada media tanah dalam pot bisa ditutup dengan batu-batuan, terutama jenis batu koral. Selain memperindah tampilan, batu koral juga berfungsi untuk memperkecil kemungkinan tanah didalam pot akan keluar dan membuat kotor lantai. Sumber: http://www.imagebali.net/detail-artikel/291-trik-membuat-taman-di-dalam-ruang.php….. Diunduh 6/4/2012

    20. TRIK MEMBUAT TAMAN DI DALAM RUANG Batu koral juga bisa ditempatkan pada lantai di sekitar tanaman pot. Hal ini sangat bagus dilakukan jika tanaman dikumpulkan menjadi satu secara bergerombol, namun dengan penataan yang rapi dan seksama. Jika menginginkan media tanam tanpa menggunakan pot, maka perhitungkan jaminan kebersihan dari taman tersebut.  Jangan sampai terjadi taman tersebut justru menimbulkan kesan yang kotor dan tidak rapi. Tempat yang paling bagus untuk menempatkan taman jenis ini adalah di bagian pinggir atau pojok ruang. Agar tetap terlihat bersih, pada bagian luar taman tersebut juga ditutup dengan bahan yang sama yaitu batu koral atau batu alam yang lain. Perhitungkan pula dengan cermat arah aliran air ketika melakukan penyiraman. Jangan sampai air meluber hingga masuk ke lantai. Perhatikan dengan seksama terutaman pada bagian daun suatu tanaman. Jika warnanya berubah menjadi pucat atau kusam, itu pertanda jika tanaman tersebut sudah mulai tidak sehat sehingga perlu mendapat kesegaran yang baru. Keluarkan tanaman dan biarkan selama dua atau tiga hari di luar ruang.  Jika warna daunnya sudah kembali cerah, tanaman bisa dibawa masuk kembali. Untuk tanaman yang ditanam secara langsung dalam ruang, tentu pekerjaan ini sulit dilakukan. Maka jalan terbaiknya adalah lebih sering membuka jendela atau pintu kamar , terutama yang secara langsung bisa memasukan sinar matahari dan udara ke dalam ruang. Factors In Choosing The Best Indoor Plants: Lighting Temperature Humidity Space availability Time availability When searching for the best indoor plants for low light conditions, find a plant with a light but expansive root system and stem structure. Possibilities include the Ficus and Chinese Evergreen. Both of these plants grow well with limited or indirect lighting. They are also very easy to maintain. Simply keep the soil moist and enjoy the benefits. http://bestindoorplants.net/ Sumber: http://www.imagebali.net/detail-artikel/291-trik-membuat-taman-di-dalam-ruang.php….. Diunduh 6/4/2012

    21. TIPS MEMILIH CAT RUMAH . Apa pentingnya memilih cat rumah? Jangan anggap sepele cat rumah . Cat atau polesan terhadap dinding rumah bukan hanya berfungsi untuk menjaga keawetan bangunan rumah, namun yang lebih penting adalah fungsi estetika yang akan muncul dari ketangkasan Anda dalam memilih cat warna rumah yang sesuai. Banyak rumah yang dibangun dengan harga cukup mahal namun pada akhirnya terlihat sebagai bangunan kuno yang tidak menarik, hal ini salah satunya disebabkan oleh ketidak tahuan Anda  mengenai tips memilih cat rumah yang sesuai. Atau terkadang sebuah bangunan rumah mungil sederhana, namun tampak indah dan asri hanya karena kepintaran si pemilik rumah dalam memilih cat rumah yang sesuai untuk tempat huniannya. Oleh karenanya, jika Anda ingin mendirikan sebuah rumah, hal yang cukup penting untuk dipikirkan adalah soal warna cat yang akan Anda pilih seperti apa, bagus atau tidak kualitasnya. Untuk bisa menghasilkan sebuah bangunan rumah dengan warna cat yang baik, tentunya diperlukan tips memilih cat rumah agar Anda tidak salah pilih cat. Pada bahan-bahan alami bangunan rumah seperti papan, bambu, atau bahkan besi, cat digunakan untuk menjaga keawetan bahan, oleh karenanya Anda juga harus cerdas memilih cat rumah dengan beragam fungsinya. Nah, berikut disajikan beberapa tips memilih cat rumah yang sesuai untuk rumah Anda: 1. Memilih warna-warna senadaPerbedaan yang mencolok antara bangunan rumah di daerah perkotaan dengan pedesaan, atau bangunan rumah yang dirancang oleh seorang arsitek dengan rancangan pribadi pemilik rumah terkadang soal memilih cat. Rumah-rumah di pedesaan cenderung memilih warna serabutan yang tidak saling berhubungan satu sama lain alias tabrak warna. Misalnya warna hijau dikombinasikan dengan biru. Hal ini jelas sangat merusak pemandangan. Lain halnya jika pemilihan warna tak selaras tersebut dimunculkan pada gaya desain ruangan minimalis modern . Itu pun biasanya perpaduan warna mencolok diletakkan pada warna asesoris atau furniture ruangan, bukan pada dinding. Pilih lah warna dinding yang senada satu sama lain, sehingga kesan yang muncul cukup memberi kenyamanan pada mata. Sumber: http://www.imagebali.net/detail-artikel/38-Tips-Memilih-Cat-Rumah.php….. Diunduh 6/4/2012

    22. TIPS MEMILIH CAT RUMAH 2. Pilih lah cat warna dinding yang lebih muda dari lantai ruanganSama hal nya dengan memilih baju, memilih cat rumah juga diusahakan untuk bagian atas lebih muda dari pada bagian bawah. Pilih lah warna lantai rumah yang lebih tua di banding warna dinding rumah, atau carilah warna cat dinding rumah yang lebih muda dibanding warna lantai. Misalnya jika Anda memilih warna ubin coklat, maka pilih lah cat dinding rumah warna coklat muda yang lebih muda dibandingkan warna lantai. Penggunaan warna ini akan lebih memberi kesan indah dibanding jika Anda memposisikan warna cat sebaliknya, yakni warna lantai jauh lebih muda dari pada dinding, maka nuansa ruangan akan terasa gelap. 3. Carilah kualitas cat terbaikMemilih cat rumah juga tidak terlepas dari soal kualitas. Carilah kualitas cat terbaik yang sesuai dengan kondisi keuangan Anda. Namun memiliki cat dengan kualitas yang bagus akan membuat dinding rumah lebih awet dan Anda juga akan bertahan cukup lama tidak melakukan pengecatan ulang. Apabila Anda memilih cat rumah dengan kualitas rendah maka warna cat akan cepat rusak dan Anda diharuskan mengecat ulang. Hal ini justru jauh lebih sulit bukan dibanding dengan Anda langsung saja memilih cat rumah dengan kualitas terbaik. Deluxe Indoor Flowering Plant For the best seasonal selection, such as an azalea, hydrangea, or cyclamen. The seasonal varieties may include kalanchoes, gloxinias, persion violets. (https://www.800florals.com/order.asp?item=P420X) Sumber: http://www.imagebali.net/detail-artikel/38-Tips-Memilih-Cat-Rumah.php….. Diunduh 6/4/2012

    23. BEBERAPA PRINSIP PEMBANGUNAN RUMAH SEHAT Rumah sehat, tentunya menjadi harapan kita semua, baik bagi pemilik dan penghuninya ataupun bagi lingkungan dan masyarakat di sekitarnya. Apa saja kah yang perlu kita perhatikan untuk mewujudkan rumah sehat yang akan kita tinggali, berikut ini 5 prinsip dari rumah sehat : 1. Pencahayaan Alami Posisi bangunan sangat berpengaruh pada pencahayaan alami ini, karena satu-satunya sumber cahaya alami adalah matahari, jadi kita tidak bisa menentukannya sendiri tetapi posisi bangunan atau rumah yang akan kita bangun lah yang harus menyesuaikan pada cahaya matahari yang nantinya akan masuk, atau jika anda terlanjur membangun rumah dengan posisi yang tidak memungkinkan masuknya cahaya matahari, anda bisa mengakalinya dengan membuat skylight, misalnya buatlah kaca transparan di langit-langit rumah anda., bisa juga dengan memasang kaca jendela transparan, ruang tanpa sekat massif dan cat ruangan berwarna putih untuk memantulkan cahaya lampu sehingga bisa menerangi ruangan dengan maksimal. Selain untuk alas an kesehatan, pencahayaan alami yang cukup juga akan banyak bermanfaat untuk menghemat listrik, kita tidak perlu menyalakan lampu untuk menerangi bagian dalam rumah, karena semuanya sudah terpenuhi oleh cahaya matahari yang masuk. Cahaya matahari bisa dimanfaatkan dengan optimal sebagai sumber cahaya alami untuk rumah sehat, dengan pedoman: a. Orientasi Bangunan Bangunan sebaiknya menghadap Utara-Selatan agar terhindar dari panas langsung matahari, karena bagaimanapun pentingnya sinar matahari jika terkena langsung dalam waktu terus-menerus akan berakibat kurang baik. b. Ukuran Ruangan dan Bukaan Agar cahaya matahari yang masuk mencukupi, dan dapat menerangi ruangan dengan maksimal, sebaiknya ukuran lebar ruangan dibuat 2 kali ukuran tinggi bukaannya. Sumber: http://www.imagebali.net/detail-artikel/157-prinsip-pembangunan-rumah-sehat.php….. Diunduh 6/4/2012

    24. BEBERAPA PRINSIP PEMBANGUNAN RUMAH SEHAT 2. Ventilasi Alami Pada prinsipnya ventilasi alami adalah menciptakan sirkulasi udara dengan membuat lubang-lubang pada bagian dinding bangunan untuk memasukan udara segar dari luar sehingga udara panas yang ada di dalam bisa digantikan dengan baik. 3. Sistem Manajemen Limbah Sistem manajemen limbah yang baik sangat penting demi terciptanya lingkungan rumah yang bersih dan sehat, untuk dapat menangani limbah tentu saja kita harus mengetahui terlebih dahulu jenis-jenis smpah itu sendiri, agar memudahkan kita melakukan pembersihan, penyortiran, pengemasan serta melakukan pembuangan akhir. Kenapa harus seperti itu? Karena untuk setiap jenih limbah yang berbeda akan memerlukan penanganan yang berbeda juga, seperti adanya sampah organik dan non organic yang perlu kita pilah dan pisah ketika ingin membuangnya, dan lingkungan kita pun akan lebih sehat. 4. Penampungan Air Hujan Untuk memanfaatkan air hujan, bisa kita tampung ke dalam kolam atau tong besar. Tentunya air hujan yang kita tampung tadi bisa kita manfaatkan untuk kebutuhan sehari-hari, seperti menyiram tanaman mencuci mobil atau menyiram toilet, tapi perlu diperhatikan juga ketika air hujan dalam penampungan tersebut terlalu lama tersimpan biasanya akan jadi rumah nyamuk untuk bertelur dan akan sangat berbahaya bagi kesehatan anda dan keluarga, jadi solusinya anda bisa menggunakan abate ke dalam bak penampungan, atau jika media penampungan tersebut berupa kolam, anda bisa memelihara ikan di sana sebagai predator dari jentik-jentik nyamuk yang mungkin ada. 5. Lapisan Tembus Air Halaman rumah sebaiknya tidak kita buat dengan menutupinya dengan tembok atau cor beton seluruhnya, daerah resapan air pun sangat perlu kita buat di sekitar rumah, selain untuk menghindari genangan air juga sebagai media seni sehingga rumah kita akan terlihat lebih cantik jika kita bisa mengaturnya sedemikian rupa. Kita bisa menanami rumput, grass block ataupun tanaman lain di halaman rumah, agar air dapat mengalir dan proses peresapan ke dalam tanah bisa lancar, sehingga bila semua rumah menerapkannya, maka akan tercipta lingkungan yang bebas banjir. Sumber: http://www.imagebali.net/detail-artikel/157-prinsip-pembangunan-rumah-sehat.php….. Diunduh 6/4/2012

    25. MERANCANG RUANGAN PENANGKAL STRES Stres pada masa kini seringkali menjadi masalah yang serius dalam kehidupan manusia modern yang semakin sibuk dan penuh tekanan. Selain menghindari polusi, atau situasi yang membuat stres rumah pun merupakan tempat yang paling tepat untuk membantu menanggulangi stres. Rapi dan TerorganisasiRumah yang rapi dapat mengurangi stres. Kurangilah benda-benda yang tidak trepakai agar rumah tidak tampak penuh dan berantakan. Rumah yang acak-acakan menggambarkan kemalasan, tidak bersih, dan kurang mencintai diri sendri.Anda tidak perlu memajang semua benda kesayangan sekaligus, tetapi simpanlah beberapa diantaranya dan tukarlah selang setiap waktu tertentu. Kegiatan ini akan membantu Anda dalam menanggulangi stres karena kegiatan Anda akan terpaku pada hal-hal yang Anda senangi.Warna kuning muda atau kuning emas pada dinding dapat merangsang otak untuk berpikir jernih dan mengurangi stres. Berilah ruang gerak yang cukup dalam rumah untuk memastikan Anda menyimpan barang-barang di tempat alternatif, misalnya dengan menyimpan di bawah tempat tidur, atau gudang bawah atap. Mengatasi Sulit TidurSulit tidur adalah salah satu akibat yang paling umum dari stres. Untuk menguranginya pastikan ruang tidur, berada jauh dari kebisingan seperti jalan, dan sebaiknya dekat dengan taman belakang. Beri warna dinding yang membuat pikiran menjadi rileks seperti warna pink, oranye paste muda, biru atau hijau lembut. Lampu tidur berwarna hijau juga akan menenangkan pikiran.Bakarlah lilin wangi atau minyak esensial sebelum tidur. Terlevisi, atau benda-beda elektronik sebaiknya tidak berada dalam kamar tidur . Terpaku menonton semua program justru akan menambah stres, mengurangi motivasi hidup, dan vitalitas fisik Anda. Selain itu ruang tidur sebaiknya terpisah dari ruang kerja. Benda-Benda Kecil yang PentingSeringkali kita kehilangan benda-benda kecil yang penting di dalam rumah, seperti kunci, kacamata, dompet, dan lain-lain. Oleh karena itu Anda dapat mensiasatinya dengan membeli rak unik dan letakkan di depan dekat pintu, dan biasakanlah untuk menyimpan semua benda-benda kecil tadi di dalamnya. Sumber: http://www.imagebali.net/detail-artikel/18-Merancang-Rumah-Penangkal-Stres.php….. Diunduh 6/4/2012

    26. MERANCANG RUANGAN PENANGKAL STRES Sosialisasi Hal yang sangat disayangkan bila saat ini menjamu tamu di rumah sudah sangat jarang dilakukan, sebaliknya menjamu tamu di restoran tampaknya menjadi favorit banyak orang. Padahal bersosialisasi dengan menjamu tamu di rumah sendiri ini lebih rileks, akrab, dan menciptakan kehangatan bagi penghuni maupun tamu yang Anda jamu. Sekali-sekali undanglah sahabat untuk makan malam di rumah Anda. Menjamu tamu di rumah akan membuat Anda terpacu untuk lebih memperhatikan tatanan interior rumah . Anda juga jadi alasan untuk membeli alat-alat baru, dan kegiatan ini akan terasa menenangkan. Ciptakan kegiatan yang santai setelah makan, misalnya nonton video bersama, melakukan permainan, atau mendengarkan musik untuk mengobrol.Tatalah rumah dengan atmosfer yang menyenangkan dan hangat seperti penerangan lilin-lilin, serta bunga segar. Warna cerah akan menambah kehangatan jamuan. Tata furniture dengan lay out yang akrab, kursi, dan sofa hendaknya dalam posisi berdekatan. Indoor plant = Filtering the Air Any lingering volatile organic compounds can be filtered from the air to improve indoor air quality. In studies intended to find ways to purify air for extended stays on space stations, NASA discovered that many common household plants also remove toxic volatile organic compounds such as trichloroethylene, benzene and formaldehyde from the air. The study also showed that some plants are better at removing chemicals from the air. Below is a list of plants and the volatile organic compounds, and other indoor toxins they remove. Philodendrons, Spider plants, Pothos and Money plants remove formaldehyde present in carpets, and furniture (particularly flat pack particleboard furniture and foam insulation). English Ivy and Boston Ferns remove airborne mold. The Areca palm removes indoor chemicals and acts as a humidifier. Gerbera Daisies and Chrysanthemums clear benzene and trichloroethylene found in plastics, synthetic fibers, detergents, varnishes, adhesives and dry cleaning from indoor air. Perpustakaan Mini Membaca buku akan membuat hidup Anda lebih berarti. Selain menambah pengetahuan, dan kekayaan pikiran, buku-buku yang tersusun rapi di rumah Anda akan memberikan kesan bersahabat dan hangat dalam rumah Anda. Rumah tanpa buku akan terasa kosong, dan terasa kaku serta kurang bersahabat. Oleh karena itu bila memungkinkan ciptakanlah taman membaca di salah satu sudut pada rumah Anda.Membaca beberapa lembar buku sebelum tidur juga akan merangsang imajinasi serta kreatifitas Anda. Letakkan beberapa buku di meja sisi, tempat tidur sehingga Anda selalu ingat untuk membaca sebelum tidur. Sumber: http://www.imagebali.net/detail-artikel/18-Merancang-Rumah-Penangkal-Stres.php….. Diunduh 6/4/2012

    27. PERANCANGAN SANITASI RUMAH Sanitasi merupakan bagian penting dalam pembangunan sebuah bangunan atau rumah, tapi kadang banyak dari kita yang kurang menyadarinya, karena melihat begitu pentingnya sanitasi bahkan tokoh dunia sekelas Mahatma Ghandi pernah berkata ‘sanitation is more important than independence’, bagi bangunan atau rumah tinggal modern sat ini mungkin kata-kata itu ada benarnya, sanitasi yang baik bisa lebih berharga dari kemerdekaan, bayangkan ketika kita memasuki sebuah bangunan modern tiba-tiba saja tercium aroma kurang sedap dari toilet atau bau busuk dari saluran pembuangan limbah yang tersendat, tentu saja citra si pemilik bangunan akan langsung jelek di mata kita, sepertinya memang hal sepele, tetapi jika kita abaikan itu bisa jadi sebuah bencana bagi sang pemilik.Ada beberapa hal yang perlu diperhatikan dalam merancang sebuah system sanitasi di rumah, di antaranya penyediaan air bersih dan pengolahan limbah.1.Instalasi Air BersihTersedianya air bersih yang cukup tentu saja menjadi factor utama dalam sanitasi pada rumah, apapun kegiatan sanitasi yang kita lakukan di rumah biasanya memakai air bersih, baik itu penggunaan secara langsung maupun sebagai pelengkap saja.Untuk itu perlu diperhatikan dalam membuat instalasi untuk air bersih, paling tidak ada 2 model instalasi yang dapat diterapkan untuk rumah : a.Instalasi TerbukaSaluran utama mengalir lurus dari tangki utama ke titik-titik disepanjang pipa dan berakhir pada satu titik. b.Instalasi tertutupSaluran utama mengalir dari pompa atau tangki air ke titik-titik percabangan saluran anak, ujung saluran utama ini berakhir di dekat pompa atau tangki air.2.Instalasi LimbahSaluran pipa ganda di sisi kanan dan kiri rumah adalah alternative terbaik untuk system pembuangan air limbah, tapi system ini juga tetap memiliki untung dan rugi.Keuntungannya, jika salah satu saluran pipa pembuangan mampet atau tersendat maka saluran pembuangan lainnya masih bisa berfungsi, hanya saja untuk saluran pipa ganda pemakaian pipa PVC menjadi boros karena memakai pipa dengan jumlah 2 kali lebih banyak daripada memakai saluran pipa tunggal.Jika ingin hemat, anda bisa menggunakan system saluran pipa tunggal, pipa utama bisa di tempatkan di salah satu sisi bangunan atau rumah, untuk menghindari mampet sebaiknya pipa yang digunakan berukuran tidak kurang dari 4 inchi. Sumber: http://www.imagebali.net/detail-artikel/162-hal-penting-dalam-perancangan-sanitasi-rumah.php….. Diunduh 6/4/2012

    28. PERANCANGAN SANITASI RUMAH 3.Septic Tank Untuk pembuatan septic tank pun sebenarnya ada Standar Nasional Indonesia nya.. Standar ini mencakup sistem, ukuran, dan prosedur pembuatannya. Dalam SNI, ukuran dimensi septic tank ditetapkan berdasar jumlah penghuni rumah. Untuk rumah dengan lima penghuni, volume septic tank bisa dihitung berikut ini :ruang basah 1,2m3, ruang lumpur 0,45m3, dan ruang ambang batas bebas 0,4m3. Jika dibuat dalam rumus panjang x lebar x tinggi yaitu : 1,6m, x 0,8m, x 1,6m. Dengan volume tersebut, septic tank bisa bertahan selama 3 tahun tanpa pengurasan.Dalam membuat atau memilih tangki yang sudah jadi, kita juga harus memperhatikan kekuatannya. Tangki harus tahan terhadap asam, dan kedap air, tidak boleh ada rembesan dari tangki sehingga dapat mencemari lingkungan sekitar. Untuk itu, tangki dapat dibuat dari batu kali, bata merah, batako, atau beton. Bisa juga menggunakan tangki dari keramik, pvc, plastik, atau besi. Jarak tangki ke bangunan juga perlu diperhatikan, yaitu 1,5m, sedangkan jaran tangki ke sumur air bersih 10m, dan 5m untuk jarak tangki ke sumur resapan air hujan. Aneka tanaman hias yang cocok untuk lingkungan di luar ruangan http://greenmall.tradeindia.com/Exporters_Suppliers/Exporter25805.670510/Live-Outdoor-Plant.html Sumber: http://www.imagebali.net/detail-artikel/162-hal-penting-dalam-perancangan-sanitasi-rumah.php….. Diunduh 6/4/2012

    29. Green Hospital and Inspiring Action In  RSJ Dr.Radjiman Wediodiningrat Lawang IntruksiMenteriDalamNegeri No. 14 Tahun 1988 mengemukakanbahwaruangterbukahijaumemberikanmanfaatsebagaiberikut : Memberikankesegaran, kenyamanandankeindahanlingkungan Memberikanlingkunganbersihdansehat Memberikanhasilproduksiberupakayu, daunbunga, biji, sertabuahatauhasillainnya. Udaraalami yang bersihseringdikotoriolehdebu, baik yang dihasilkanolehkegiatanalamimaupunkegiatanmanusia. Langkahnyatadankongkretmewujudkan Green Hospital sedangdirintis RSJ Dr. RadjimanWediodiningratLawang. Salahsatudarikonsep yang sedangdigagasadalahrencanamemaksimalkanlahantidurmilik RSJ Dr. RadjimanWediodiningratLawang yang jumlah total luasnyamencapai 295 hektare, dansementaraini yang termanfaatkanhanya 20 persennyasaja. Konsep Green Hospital adalahlingkunganuntukmewujudkankenyamananekologisbagipasiensertawargamasyarakat yang tinggaldisekitarlingkungan RSJ. Green Hospital adalahRumahSakit yang berwawasanlingkungandanmerupakanjawabanatastuntutankebutuhanpelayanandaripelangganRumahSakit yang telahbergeserkearahpelayananparipurnasertaberbasiskenyamanandankeamananlingkunganrumahsakit. Penghijauanadalahsalahsatukegiatanpenting yang harusdilaksanakansecarakonseptualdalammenanganikrisislingkungan. Kegiatanmenambahruangterbukahijaudenganpenanaman 6.500 bibittanamandiseluruhlahanmilik RSJ dandi area sekitarmata air yang berlokasi ± 5 km dari RSJ Dr. RadjimanWediodiningratLawangpadahariRabu, 25 Januari 2012 dilakukan Dr. BambangEkoSunaryanto, Sp.KJselakuDirekturUtama, bersamapasien yang masukmasapemulihan, dokter, perawat, dananggotadewanpengawas RSJ dilakukansebagaiupayauntukmenyongsongpenerapankonsep Green Hospital di RSJ Dr. RadjimanWediodiningratLawanguntukmewujudkanlingkungan yang sehatdanaman, disampingituterpenuhinyaunsurkenyamananekologisdanestetikajugamerupakansalahsatupertimbanganpasiendalampemilihanrumahsakit.Semogamelaluikonsep Green Hospital di RSJ Dr. RadjimanWediodiningratLawangdapatmenginspirasilebihbanyakoranguntuklebihtergugahsebagaiwujudkeperdulianlingkungan. Let’s keep our world green forever. (srs) Lawang, 9 Februari 2012 Sumber: http://www.rsjlawang.com/berita_120229a.html….. Diunduh 6/4/2012

    30. MUTU PELAYANAN RUMAH SAKIT Mutupelayananrumahsakitdapatdilihatdarisegiaspek yang berpengaruh. Aspekberartihal-hal yang secaralangsungatautidakberpengaruhterhadappenilaian. Keempataspektersebutadalahsepertiberikut : a. Aspekklinis Menyangkutpelayanandokter, perawatdanterkaitdenganteknis medis. (Indikatorklinisterdiridari : Angkainfekinosokomial; Angkakematianrumahsakit; Kasuskelainan neurology yang timbulselamapasiendirawat; Timbulnyadekubitusselamaperawatan; Indikasioperasitidaktepat; Salah yang dioperasi; Kesalahanteknikoperasi; Komplikasipembedahan; Perbedaanantaradiagosaprabedahdenganpenemuanpatologianatomipascabedah; Operasiulanguntukmenanggulangipenyulit; Infeksipascabedah; Kematiankarenaoperasi; Reaksiobat; Komplikasipengobatanintravena; Reaksitranfusi; Angka section Caesar yang tidakwajartingginya; Angkakematianibumelahirkan. b. Aspekefisiensidanefektifitas Pelayanan yang murah, tepatguna, takadadiagnosadanterapi berlebihan. (Indicator aspekefisiensidanefektifitasterdiridari : Pasienmenungguterlalu lama dikamaroperasi, kamarrontgendan lain-lain sebelumditolong; Persiapandikamarbedah, kamarbersalintidakbaik; Masalahdenganlogistikkamarbedah, ruangperawatan, kamarbersalin; Masalahpemakaianobat; Masalahlamanyapasiendirawat; Masalahdenganprasarana (listrik, air, instalasi gas); Masalahteknisdenganalat-alatdanperlengkapan; Masalahdengansumberdayamanusia; Proseduradministrasi yang rumit. Sumber: http://digilib.unimus.ac.id/files/disk1/108/jtptunimus-gdl-yudaayutim-5369-2-bab2.pdf ….. Diunduh 6/4/2012

    31. MUTU PELAYANAN RUMAH SAKIT Mutupelayananrumahsakitdapatdilihatdarisegiaspek yang berpengaruh. Aspekberartihal-hal yang secaralangsungatautidakberpengaruhterhadappenilaian. Keempataspektersebutadalahsepertiberikut : c. Aspekkeselamatanpasien Upayaperlindunganterhadappasien, misalnyaperlindunganjatuhdari tempattidur, kebakaran. (Indicator keselamatanpasienterdiridari : Pasienterjatuhdaritempattidur, dikamarmandi, toilet; Pasiendiberiobat yang salah; Pasienlupadiberiobat; Tidakadaalatatauobat emergency ketikadibutuhkan; Tidakdilakukan cross match padapasien yang ditranfusi; Tidakadaoksigenketikadibutuhkan; Infeksinosokomial; Alatpenyedotlendir yang tidakberfungsidenganbaik; Alat anesthesia tidakberfungsibaik; Alatpemadamkebakarantidaktersedia; Tidakadarencanapenanggulanganbencana. d. Aspekkepuasanpasien Berhubungandengankenyamanan, keramahandankecepatanpelayanan. (Indikatoraspekkepuasanpasienterdiridari : Jumlahkeluhandaripasiendankeluarga; Hasilpenilaiandengankuiseneratausurvaytentangderajatkepuasanpasien; Kritikdalamkolomsuratpembaca Koran; Pengaduan mal praktek; Laporandaristafmedikdanperawatantentangkepuasanpasien) Sumber: http://digilib.unimus.ac.id/files/disk1/108/jtptunimus-gdl-yudaayutim-5369-2-bab2.pdf ….. Diunduh 6/4/2012

    32. KUALITAS PELAYANAN KEPERAWATAN Pelayanankeperawatanmerupakanbagian integral daripelayanan kesehatan. Di rumahsakit, keperawatnmenjadisalahsatuprofesi yang berperandalam quality assurance (Aditama, 2003) yang dilakukandengan pengelolaanasuhankeperawatansecara professional yang memfokuskan padakebutuhanpasiendankeluarganya (klien) denganintervensi yang melandaskanpadailmukeperawatan (Nurachmah, 2001). Asuhankeperawatan yang berkualitasmerupakanasuhanmanusiawi yang diberikankepadaklien, memenuhistandartdan criteria profesikeperawatan, sesuaidenganstandartbiayadankualitas yang diharapkanrumahsakitsertamampumencapaitingkatkepuasandanmemenuhiharapanklien. Kualitastersebutdipengaruhiolehkondisipasien, tenagakeperawatan, system manajerial, kemampuanrumahsakitdalammemenuhisaranadanprasarana, sertaharapanmasyarakatterhadappelayanankesehatan/ keperawatanrumahsakit. Untukmenciptakankualitastersebutdiatas, perludiperhatikankomponenberikut : Terlihatsikap caring ketikamemberikanasuhankeperawatankepadaklien. Sikapinidiyakinisebagaiesensikeperawatan. Merupakantindakan yang bertujuanmemberikanasuhanfisikdanmemperhatikanemosisambilmeningkatkan rasa amandankeselamatanklien (Carruth et al. cit. Nurachmah, 2001). Perawatmenawarkansebuahkejujuran, kepercayaandanniatbaikuntukmeningkatkanperubahanpositifkliendalamaspekfisik, psikologis, spiritual dan social (Nurachmah, 2001). Hubunganperawat-klien yang terapeutikdantimbalbalik agar efektifitasintervensimeningkat. Hubungandibentukmelaluiprosespembinaandanpemahamanduabelahpihak. Perawatmemprakarsaisikapempatidankeinginanberesponsertakeinginanmenolongklien. Keberhasilaninimenentukankeberhasilanhasiltindakan yang diharapkan (Nurachmah,2001). Kemampuandalammemenuhikebutuhanklien, karenarangkaiankegiatankeperawatandiorientasikankepadaklien. Hal inidipengaruhikemampuanperawatdalamberresponterhadapkeluhandanmasalahkliensertaupayamenanganinyasesuaikebutuhanklien (Nurachmah, 2001). Kolaborasidengananggotatimkesehatan lain. Quality assurance, yaitumembandingkanantarastandart yang telahditetapkandenganhasil yang dicapai yang dilakukandenganmenilai, memantau,ataumengaturpelayanan yang berorientasipadaklienmeliputiaspekstruktur, prosesdan outcome (Nurachmah, 2001).

    33. KEPUASAN PASIEN • 1. PengertianKepuasanPasien • Tingkat kepuasanmerupakanevaluasipurnabelidimanaalternatif • yang dipilih minimal memberikanhasilsamaataumelampauiharapan • (Engel et al., 1990 Tjiptono, 2000). Kotler (1994) mengungkapkan • kepuasansebagaitingkatperasaanseseorangsetelahembandingkankinerja (hasil) yang dirasakandenganharapannya. Sehinggadapatdinyatakanbahwaharapandankinerja yang dirasakanmerupakankomponenpokokkepuasankonsumen/ pelanggan. • Harapanmerupakanperkiraanataukeyakinankonsumententangapa yang akanditerimanyabilaiamembeliataumengkonsumsibarangataujasa. Sedangkankinerja yang dirasakanmerupakanpersepsikonsumenterhadapapa yang iaterimasetelahmengkonsumsiprodukataujasa yang dibeli. • Dalammenggunakansuatujasa (pelayanan), konsumenseringkalimempunyaiskenariotentangapa yang akanditerimanya, berupa : • Jasa ideal, (2) jasa yang diantisipasiatauharapan, (3) Jasa yang selayaknyaditerima, (4) Jasa minimum yang dapatditoleransi. • Apabilajasa minimal yang diharapkanadalah ”jasa yang dapatditoleransi”, lalu yang terjadisamadenganataubahkanmelampauiharapantersebut, makakonsumenakanmerasakankepuasan. Sedangkanapabilajasa yang diharapkanadalah ”jasa ideal”, tetapi yang terjadikurangdariharapantersebut, makakonsumenakanmerasakanketidakpuasan. Dari penjelasantersebutterlihatjelasbahwakonsumenmemilikiperanbesarsebagaistandartperbandinganevaluasikualitasmaupunkepuasan. • Kepuasanpasienadalahnilaisubyektifterhadapkualitaspelayanan yang diberikan. Walaupunsubyektiftetapadadasarobyektifnya, artinyawalaupunpenilaianitudilandasiolehhaldibawahini : • Pengalamanmasalalu; • Pendidikan; • Situasipsikiswaktuitu; • Pengaruhlingkunganwaktuitu.

    34. ASPEK KEPUASAN PASIEN Kepuasanpasienmeliputiempataspekdibawahini : a. Kenyamananmeliputi ; Lokasirumahsakit, kebersihanrumahsakit, kenyamananruangan, makanandanperalatanruangan. b. Hubunganpasiendenganpetugasrumahsakitmeliputi ; Keramahan, informasi, komunikatif, responatif, suportifdancekatan. c. Kompetensiteknispetugasmeliputi ; Keberanianbertindak, pengalaman, gelardanterkenal. d. Biayameliputi ; Mahalnyapelayanan, sebandingnya, terjangkautidaknyadanadatidaknyakeringanan. Walaupundemikiankeempathalinitidakselamanyamudahdinilaidandipertanyakandalamquisoner. A lot of people count us lucky to always have flowers in the house.  And we are.  But today, we would like to highlight plants as well. There’s something delightful about going inside a home filled with plants. The air’s a little bouncier, and you can actually breathe easy. And since you spend most of your time indoors, it helps to have a breath of fresh air especially when you live right smack in the middle of smoke city. In fact, indoor plants not only produce oxygen, they also absorb benzene, formaldehyde,  xylene, toluene and trichlor. Mother In Law's Tongue Sumber: http://flowerdepot.wordpress.com/2011/08/05/indoor-plants-as-air-filters/ ….. Diunduh 6/4/2012

    35. PENGUKURAN TINGKAT KEPUASAN Salah satu metode yang digunakan untuk mengukur kepuasan konsumen adalah mengajukan pertanyaan kepada pelanggan menyangkut dua hal utama, yaitu harapan dan persepsi (kinerja) yang dirasakan (Kotler, 1994). Metode lain yang dapat digunakan adalah dengan pendekatan hipotesis bahwa pelayanan ditentukan oleh perbedaan harapan dan persepsi (Hart, 1999). Rubber Plant You supposedly need 1 plant for every 1 square meter of floor space. You need not keep these plants near the window all the time nor do they need direct sun.  Bi-weekly by the window with some filtered sun does the trick.  I also water only once or twice a week. Sumber: http://flowerdepot.wordpress.com/2011/08/05/indoor-plants-as-air-filters/….. Diunduh 6/4/2012

    36. Evaluasi kenyamanan pada beberapa taman kota di Jakarta Pusat Putra, Priambudi Trie. http://repository.ipb.ac.id/handle/123456789/46755 . Date: 2011 . Keberadaan taman kota merupakan hal mutlak untuk menjamin kelangsungan ekologis kota serta menjadi ruang interaksi sosial bagi warga kota. Fungsi taman kota adalah untuk ameliorasi iklim serta merekayasa lingkungan. Fungsi ameliorasi iklim yaitu berupa menurunkan suhu dan memodifikasi kelembaban iklim mikro kota. Fungsi rekayasa lingkungan yaitu berupa mengurangi erosi, meningkatkan kualitas udara kota, menjadi tempat habitat satwa liar, dan mengurangi kebisingan. Kenyamanan merupakan hal yang ingin dicapai dengan adanya taman kota. Selain menyajikan kenyamanan, taman kota sebagai bagian dari ruang terbuka hijau (RTH) akan mampu meningkatkan kualitas kehidupan lingkungan perkotaan yang umumnya didominasi oleh struktur bangunan Kawasan Menteng di Jakarta Pusat merupakan kota taman pertama di Indonesia yang memiliki beberapa taman kota seperti Taman Menteng, Taman Suropati, dan Taman Situ Lembang. Kawasan Menteng merupakan model dari kota taman yang mengharmonisasikan penggunaan ruang sehingga dapat menciptakan lanskap kota yang nyaman. Tujuan penelitian ini adalah mengevaluasi kenyamanan Taman Menteng, Taman Suropati, dan Taman Situ Lembang berdasarkan pengambilan data langsung (suhu dan kelembaban) serta responden dari masing-masing taman. Metode yang digunakan dalam penelitian ini yaitu metode grid berukuran 20 meter x 20 meter untuk mengetahui sebaran suhu dan kelembaban di masing-masing taman. Di tiap grid dilakukan pengambilan data suhu dan kelembaban aktual dengan tiga kali ulangan. Pengambilan data dilakukan pada siang hari terik pukul 12.30-13.00 di bulan April-Mei 2010. Data berupa luas tutupan kanopi pohon dilakukan dengan melakukan digitasi citra taman menggunakan Google Earth 2010. Digitasi kanopi pohon menggunakan software AutoCAD 2007. Dari data luas tutupan kanopi pohon dicari hubungannya dengan data suhu dan kelembaban menggunakan persamaan regresi linier. Sumber: http://repository.ipb.ac.id/handle/123456789/46755….. Diunduh 6/4/2012

    37. Kelembaban Udara Di Ruangan . Berdasarkan data suhu udara dan kelembaban rata-rata pengamatan, dilakukan analisis menggunakan persamaan regresi linier. Analisis regresi linier digunakan untuk menilai hubungan antara faktor suhu udara maupun faktor kelembaban dengan luas kanopi pohon tiap grid dalam taman yang menghasilkan persamaan y = ax + b serta R2. Koefisien regresi yang dilambangkan dengan a, menunjukkan pengaruh luas tutupan kanopi pohon terhadap perubahan nilai suhu udara atau kelembaban dalam taman. R2 (koefisien determinasi) menunjukkan besarnya pengaruh luas tutupan kanopi pohon terhadap perubahan suhu udara atau kelembaban dalam taman. Nilai suhu udara dan kelembaban yang didapat kemudian dianalisis dengan rumus Temperature Humidity Index (THI): THI = 0,8T + (RH x T)/500 RH = kelembaban rata-rata harian (%) T = suhu udara rata-rata harian (°C) Nilai THI yang didapat dari setiap taman kemudian dianalisis menggunakan standar dari Laurie (1990) yang menyatakan bahwa lingkungan ideal memiliki suhu udara 27 – 28°C dan kelembaban 40 – 75%. Data suhu udara dan kelembaban dari tiap taman juga dispasialkan menjadi peta isoterm dan peta isohigro untuk memudahkan interpretasi mengenai sebaran titik suhu udara dan kelembaban dalam taman. Most of the commonly available indoor plants are commonly available because they have proven their ability to adapt to the very dry environments found indoors in winter. Although most indoor plants, succulents excepted, come from naturally humid habitats, many can survive quite well in low humidity, as long as they receive adequate moisture through their roots. (http://foliageconcepts.wordpress.com/) Sumber: http://repository.ipb.ac.id/bitstream/handle/123456789/46755/A11ptp_BAB%20III%20Metodololgi%20Penelitian.pdf?sequence=7 ….. Diunduh 6/4/2012

    38. Iklim Mikro Keberadaan bukaan pada lanskap kota dalam bentuk Ruang Terbuka Hijau secara langsung akan memengaruhi iklim mikro pada lokasi di sekitar tapak itu berada. Pengertian iklim mikro sendiri adalah iklim disekitar ruang antara perakaran hingga sekitar pucuk tajuk tanaman. Unsur-unsur iklim mikro terdiri dari suhu udara, kelembaban udara, angin, dan radiasi matahari. Unsur-unsur iklim tersebut akan mudah terpengaruh oleh perubahan pemanasan dan pendinginan permukaan tanah dan benda atau tumbuhan setempat. Dengan adanya tanaman, akan terbentuk iklim mikro dengan gejala penurunan suhu udara sekitar, kelembaban yang cukup, dan kadar oksigen yang bertambah. Hal ini terjadi karena adanya proses evapotranspirasi dari tanaman. Kondisi iklim mikro taman dapat dimodifikasi salah satunya adalah dengan melakukan penempatan vegetasi yang memerhatikan arah angin dan radiasi matahari. Kenyamanan Menurut Kamus Besar Bahasa Indonesia (Depdiknas, 2008), kenyamanan berarti suatu keadaan yang nyaman, sejuk, dan segar. Kenyamanan suatu taman kota ditunjukkan dengan kemampuan taman untuk dapat mengurangi pencemaran udara, menjaga kestabilan suhu udara kota, dan menjaga ketersediaan air (DPU, 2008). Dengan adanya taman kota diharapkan dapat membantu meningkatkan kenyamanan lingkungan kota dan mencegah kenaikan suhu udara kota (Frick dan Suskiyanto, 2007). Kenyamanan dapat dihadirkan dengan penggunaan jenis vegetasi seperti pohon sebagai pengontrol iklim mikro (Carpenter, Walker, dan Lanphear, 1975). [DPU] Dinas Pekerjaan Umum. 2008. Peraturan Menteri Pekerjaan Umum No: 05/PRT/M/2008 tentang Pedoman Penyediaan Ruang Terbuka Hijau di Kawasan Perkotaan. Jakarta: Direktorat Jenderal Penataan Ruang Departemen Pekerjaan Umum. Frick H dan Suskiyanto FXB. 2007. Dasar-dasar Arsitektur Ekologis. Bandung: Penerbit ITB. Carpenter PL, Walker TD, dan Lanphear FO. 1975. Plants in the Landscape. San Francisco: WH Freeman and Company.

    39. . Sabtu, 7 April 2012 Taman Menambah Keindahan dan Kenyamanan Rumah Ditulis oleh admin pada 19 Oct 2010 - 16:04 . Kehadiran taman dalam rumah dapat menjadi tempat bersantai bagi penghuni rumah. Taman dapat membuat sebuah rumah tampak lebih sejuk, indah dan nyaman. Terlebih lagi di daerah perkotaan yang marak dengan pembangunan rumah atau gedung, semakin sedikit daerah hijau yang masih ada.Tingkat kesibukan yang tinggi dan polusi udara dari asap kendaraan pada daerah perkotaan akan membuat kehadiran taman di rumah sebagai oasis untuk melepaskan lelah setiap hari. Apa saja yang harus diperhatikan ketika akan membuat taman?Dalam membuat sebuah taman, ada beberapa hal yang perlu diperhatikan agar taman yang tercipta terlihat indah dan teratur. Berikut ini beberapa hal yang harus diperhatikan saat Anda akan membuat taman.Tentukan Tema Taman Sebelum menentukan jenis tanaman yang akan dibeli, Anda harus menentukan tema keseluruhan taman. Tema taman yang dapat dipilih misalnya taman dengan tema Bali, Paris, Jepang, tropis, minimalis atau tema lainnya.Tema yang dipilih sebaiknya disesuaikan dengan luas lahan taman. Jika luas tidak terlalu besar, sebaiknya dipilih tema yang lebih sederhana, misalnya tema minimalis yang sedikit detail pada desainnya. Setelah tema ditentukan, Anda dapat memilih tanaman-tanaman, bunga atau ornamen lainnya yang mendukung tema taman.Persiapkan Instalasi Taman dan LahanPada awal pembuatan taman, jangan lupakan untuk membuat instalasi terlebih dahulu. Instalasi dan penempatan posisi listrik dan air harus diperhatikan agar ada pada tempat yang aman dan tidak mengganggu aktivitas saat berada di taman. Instalasi listrik dan air khususnya perlu mendapat perhatian apabila Anda berniat untuk membuat sebuah kolam dengan pancuran air.Hal yang tidak boleh ketinggalan untuk dipersiapkan adalah persiapan lahan. Sebagai media tanam, lahan yang akan dijadikan taman harus dibersihkan dari tanaman pengganggu atau gulma. Tanah juga perlu digemburkan dan dipupuk agar tanaman bisa tumbuh subur. Sumber: http://www.metrogaya.com/home/taman-menambah-keindahan-dan-kenyamanan-rumah….. Diunduh 6/4/2012

    40. . Sabtu, 7 April 2012 Taman Menambah Keindahan dan Kenyamanan Rumah Ditulis oleh admin pada 19 Oct 2010 - 16:04 Ciptakan Harmonisasi TanamanAgar terlihat menarik, pilih tanaman yang bervariasi. Pilih tanaman yang berbeda ukuran, jenis, atau warna sehingga taman tidak monoton. Warna pada tanaman bisa didapat dari warna bunga atau warna daunnya. Tetapi, penting untuk tetap memperhatikan keserasian taman agar taman terlihat rapi dan menarik. Keserasian taman akan tercipta dengan menentukan tanaman yang akan ditanam dan posisinya.Tanaman secara umum terbagi atas pohon yang berukuran tinggi, semak atau perdu yang lebih rendah, rumput-rumputan dan tanaman penutup tanah. Biasanya, pohon diletakkan di bagian belakang, disusul dengan tanaman perdu kemudian penanaman rumput-rumputan dan tanaman penutup tanah pada bagian depan. Atau untuk desain taman terpusat, pohon diletakkan pada bagian tengah, disusul dengan tanaman perdu yang mengitarinya dan tanaman yang lebih rendah yaitu rumput-rumputan di bagian terluar. Harmonisasi tanaman penting untuk keindahan dan kerapian taman.Pemilihan Material TamanTaman tidak hanya terdiri dari tanaman saja. Taman yang indah perlu juga didukung oleh benda-benda keras seperti pot tanaman, kolam, batu-batuan, pasir, atau benda pendukung lainnya Bagian pendukung ini disebut sebagai hardscape yang akan memberi kesan lebih dalam pada taman. Sedangkan tanaman sendiri disebut sebagai softscape.Anda perlu menyesuaikan hardscape apa saja yang akan digunakan dan seberapa banyak. Ini berkaitan dengan desain taman. Anda juga bisa menambahkan kursi taman, ayunan atau hal lain untuk menambah kenyamanan saat berada di taman. Setelah menentukan model taman, penggunaan softscape dan hardscape akan lebih mudah ditentukan.Pemilihan TanamanAgar tanaman dapat tumbuh dengan baik, harus disesuaikan dengan keadaan dan kondisi lahan taman sendiri. Apakah tempat yang akan dijadikan tanaman akan banyak terkena matahari atau tidak? Sesuaikan juga dengan kondisi lingkungan. Apakah rumah Anda berada di daerah yang sejuk atau panas? Jika taman akan banyak terkena sinar matahari, maka dapat dipilih tanaman-tanaman yang kuat terhadap sinar matahari karena jika tanaman cocok akan menyebabkan tanaman tidak berkembang atau mati. Berdasarkan kondisi taman, Anda dapat menentukan jenis tanaman apa saja yang akan menghuni taman Anda. Sumber: http://www.metrogaya.com/home/taman-menambah-keindahan-dan-kenyamanan-rumah….. Diunduh 6/4/2012

    41. Sabtu, 7 April 2012 Taman Menambah Keindahan dan Kenyamanan Rumah Ditulis oleh admin pada 19 Oct 2010 - 16:04 Pencahayaan Untuk menambah keindahan taman, tambahan pencahayaan yang baik pada taman menjadi hal yang diperlukan. Misalnya dengan memasang lampu taman atau lampu sorot taman yang mengeksploitasi suatu tanaman sebagai fokusnya. Lampu-lampu ini sangat berperan pada malam hari,sehingga pada malam hari Anda tetap dapat menikmati keindahan taman Anda dengan suasana yang romantis. Selain itu, kehadiran lampu taman dengan berbagai model akan menjadi aksesoris pemanis taman Anda.Kehadiran taman dapat menjadi hal yang penting terutama di tengah issue pemanasan global. Taman dapat membantu mengurangi polusi udara, mengurangi panas dan meningkatkan persediaan oksigen sehingga Anda dapat menikmati udara yang segar. Jika terawat dengan baik, Anda juga akan dimanjakan pemandangan yang indah di rumah sendiri. Menghabiskan waktu di taman tentu akan menyenangkan. What Kind of Lighting Should Be Used for Indoor Growng? Sunlight contains the full spectrum of light that plants need to grow, but plants growing indoors need lighting supplements to provide the energy for photosynthesis. Blue and red light waves are the two primary colors that your indoor plants need to thrive; different plants require different levels of each. Select your indoor lighting based on the types of plants you are growing in combination with the amount of daily sunlight your plants receive. Fluorescent Fluorescent grow lights are the most common options for homeowners growing plants indoors. You can purchase different types of fluorescent bulbs that are higher in red output for growing flowers or full spectrum with a blue emphasis for promoting foliage. Fluorescent lighting works best for indoor plants when they are placed no more than two feet away from the plant. (http://www.gardenguides.com/77098-kind-lighting-should-used-indoor-growng.html) Sumber: http://www.metrogaya.com/home/taman-menambah-keindahan-dan-kenyamanan-rumah….. Diunduh 6/4/2012

    42. TAMAN KOTA (SURABAYA) Taman-taman kota Surabaya kian dipercantik. Kondisi ruang terbuka hijau makin bisa dirasakan manfaatnya oleh warga kota. Taman-taman itu menyuguhkan keindahan sekaligus kenyaman buat rekreasi keluarga warga kota. Nyaris tak ada taman kota yang dibiarkan terbengkalai. Bahkan, sebagian besar taman itu dilengkapi bermacam fasilitas untuk kenyamanan wisata keluarga, seperti jogging track, taman bermain anak, air mancur, dan lampu-lampu hias. Bahkan taman kota ini tidak saja nyaman bagi yang normal secara fisik, tapi juga bagi mereka para penyandang cacat. Tidak saja orang dewasa tapi juga anak-anak. Termasuk tidak hanya di siang hari, tapi juga malam hari tetap bisa dirasakan kenyamanan dan keelokannya. Cengkerama dan rekreasi keluarga warga kota makin memiliki banyak alternatif. Bahkan, sederet taman itu bakal dilengkapi fasilitas Hot Spot Wi-Fi untuk rekreasi dunia maya. Sejak diresmikan tanggal 21 Maret 2007, Taman Bungkul dilengkapi fasilitas skateboard & BMX track, jogging track, serta akses internet nirkabelFungsi taman kota Surabaya sebagai tempat olahraga, rekreasi warga kota, hang out, dan menghirup udara segar jauh dari polusi, makin banyak alternatif. Surabaya bahkan telah memiliki taman lanjut usia atau taman lansia. Area yang dimanfaatkan sebagai taman alternatif untuk para lanjut usia itu berlokasi di Jalan Kalimantan. Area seluas sekira 2.000 m2 eks SPBU Kalimantan itu, di set up menjadi taman yang cantik sekaligus segar. Beragam tanaman dan bunga cantik menghiasi. Di sela warna-warni tanaman indah itu tersedia track yang khusus dibuat untuk kenyamanan kursi roda para lansia. Ada pula tempat duduk untuk pengantar saat menemani para lansia menikmati suasana kota di pagi atau sore hari. Kesejukan suasana di taman ini kian segar oleh keberadaan air mancur di tengah taman. Kesegaran itu tentu bisa memecah kepekatan polusi udara dari kendaran bermotor yang cukup padat melewati bilangan ini. Sumber: http://repoebliek.wordpress.com/2011/07/16/taman-kota-surabaya/….. Diunduh 6/4/2012

    43. TAMAN PRESTASI SURABAYA . Berada di Taman Prestasi bagai menemukan sebuah oase di tengah kota. Taman seluas 6.000 m2 ini dihiasi sekitar 21 jenis tanaman sehingga terasa nyaman untuk melepas penat. Anak-anak pun dapat bermain sambil belajar mengenal lingkungannya. Area ini dilengkapi panggung terbuka, panggung teater, dan sarana permainan anak. Di sini, kita juga dapat menyaksikan replika penghargaan yang pernah diraih Kota Surabaya, seperti Wahana Tata Nugraha, Adipura Kencana, dan lain-lain. Obyek wisata ini juga menawarkan petualangan lain, seperti menyusuri Kalimas dengan perahu naga atau perahu dayung. Bahkan, bagi keluarga yang ingin menikmati suasana asri taman dengan menunggang kuda, telah tersedia kuda-kuda anak-anak. kekar yang siap mengantar. Interiorscapesand Indoor Plant Services David J. Frank Interiorscapes is division dedicated to the design, installation and maintenance of green and blooming plants for indoor environments. Adding indoors plants has an immediate positive impact, making it one of the easiest ways to create a more vibrant atmosphere within your professional, retail or residential property. Sumber: http://repoebliek.wordpress.com/2011/07/16/taman-kota-surabaya/….. Diunduh 6/4/2012

    44. Pengantar arsitektur Lanskap Taman Kota Malang Standar Taman Kota yang berlaku di Dunia. Taman merupakan salah satu obyek yang terpenting bagi orang- orang yang merasa sangat jenuh akan kesibukan kesehariannya. Kehidupan masyarakat dikota-kota besar saat ini sangat menguras tenaga dan pikiran. Masyarakat kota tersebut dipusingkan dengan keadaan yang terjadi saat ini, seperti padatnya lalu lintas akibat pengguna kendaraan meningkat sedangkan jalan yang dilalui tidak ada pelebaran, ditambah dengan pekerjaan yang terkadang membuat pikiran terkuras. Hal tersebutlah yang membuat masyarakat kota menjadi jenuh dengan rutinitas seperti itu, yang hampir setiap hari mereka hadapi. Hal tersebut akan membuat masyarakat menjadi stres dan jenuh, yang berdampak pada produktivitas mereka. Tempat terbuka dapat membantu mereka untuk santai dan sejenak melupakan permasalahan. Tempat terbuka dalam hal ini berupa taman kota. Tempat tersebut adalah taman. Taman yang ditumbuhi dengan berbagai jenis tanaman yang memiliki berbagai macam warna, hamparan rumput seperti permadani-permadani yang dapat diinjak dan ditiduri, kolam-kolam ikan yang bersih, air mancur yang indah, dan lain-lain dapat membuat kita menjadi santai, tenang, fresh, dan kembali bersemangat membuat kita siap kembali menghadapi dunia luar. Sumber: http://blog.ub.ac.id/idhayanapd/2010/11/01/pengantar-arsitektur-lanskap-taman-kota-malang/….. Diunduh 6/4/2012

    45. STANDAR TAMAN KOTA BERDASARKAN FUNGSINYA 1. Fungsi Hidrologi Taman kotaa merupakan lahan terbuka hijau yang dapat berperan dalam membantu fungsi hidrologi dalam hal penyerapan air agar pasokan air dalam tanah (water saving) semakin meningkat dan mereduksi potensi banjir dengan megurangi jumlah aliran limpasan air. Pepohonan yang ada di taman, mampu meresapkan air ke dalam tanah melalui perakarannya. Diperkirakan untuk setiap hektar ruang terbuka hijau, mampu menyimpan 900 m3 air tanah per tahun, sehingga kekeringan sumur penduduk di musim kemarau dapat diatasi. 2. Fungsi Pengaturan Iklim (Klimatologis) Taman dapat melindungi dari panas matahari dan tekanan suhu panas serta sebagai peneduh. Taman mampu menyerap panas dari atmosfer yang dekat dengan permukaan tanah disekitar tanaman, sehingga daerah disekitarnya menjadi nyaman. Penghijauan dapat memperkecil amplitudo variasi yang lebih besar dari kondisi udara panas ke kondisi udara sejuk. 3. Fungsi Psikis (Kejiwaan) Taman kota dapat membawa dan memberikan suasana sejuk dan tentram,serta damai bagi jiwa manusia. Hal ini dapat mengurangi gangguan syaraf dan kejiwaan manusia, sehingga dengan adanya taman tersebut dapat mengalihkan perhatian kita dari suasana tegang serta pengaruh kejiwaan kita menjadi tenang, karena adanya sirkulasi udara dalam kota. 4. Fungsi Kesehatan Tanaman sebagai jantungnya paru-paru kota merupakan penghasil oksigen (O2) terbesar dan penyerap karbon dioksida (CO2) dan zat pencemar udara lain, khusus di siang hari, merupakan pembersih udara yang sangat efektif melalui mekanisme penyerapan (absorbsi) dan penjerapan (adsorbsi) dalam proses fisiologis, yang terjadi terutama pada daun, dan permukaan tumbuhan (batang, bunga, dan buah). Setiap 1 hektar ruang terbuka hijau , yang ditanami pepohonan, perdu, semak dan penutup tanah, dengan jumlah permukaan daun seluas 5 hektar, maka sekitar 900 Kg CO2 akan dihisap dari udara, dan melepaskan sekitar 600 Kg O2 dalam waktu 12 jam 5. Fungsi Ekologis dan Penyeimbang Alam Secara ekologis taman kota berfungsi sebagai penjaga kualitas lingkungan kota. Dengan rindangnya taman serta banyak buah dan biji-bijian merupakan habitat yang baik bagi burung-burung untuk tinggal dan serangga untuk berkembang mambantu keseimbangan alam. Taman kota juga dapat berfungsi sebagai filter berbagai gas pencemar dan debu, pengikat karbon, pengatur iklim mikro. Sumber: ….. Diunduh 6/4/2012

    46. COMFORT NOISE Comfort noise (or comfort tone) is synthetic background noise used in radio and wireless communications to fill the artificial silence in a transmission resulting from voice activity detection or from the audio clarity of modern digital lines. Some modern telephone systems (such as wireless and VoIP) use voice activity detection (VAD), a form of squelching where low volume levels are ignored by the transmitting device. In digital audio transmissions, this saves bandwidth of the communications channel by transmitting nothing when the source volume is under a certain threshold, leaving only louder sounds (such as the speaker's voice) to be sent. However, improvements in background noise reduction technologies can occasionally result in the complete removal of all noise. Although maximizing call quality is a primary importance, exhaustive removal of noise may not properly simulate the typical behavior of terminals on the PSTN system. The result of receiving total silence, especially for a prolonged period, has a number of unwanted effects on the listener, including the following: the listener may believe that the transmission has been lost, and therefore hang up prematurely. the speech may sound "choppy" (see noise gate) and difficult to understand. the sudden change in sound level can be jarring to the listener. To counteract these effects, comfort noise is added, usually on the receiving end in wireless or VoIP systems, to fill in the silent portions of transmissions with artificial noise. The noise generated is at a low but audible volume level, and can vary based on the average volume level of received signals to minimize jarring transitions. In modern VoIP products, users may control whether they want comfort noise enabled or disabled. As part of the RTP audio video profile, RFC 3389 defines a standard for distributing comfort noise information in VoIP systems. A similar concept is that of sidetone, the effect of sound that is picked up by a telephone's mouthpiece and introduced (at low level) into the earpiece of the same handset, acting as feedback. During the siege of Leningrad, the beat of a metronome was used as comfort noise on the Leningradradio network, indicating that the network was still functioning.[1] Many radio stations broadcast birdsong, city-traffic or other atmospheric comfort noise during periods of deliberate silence. For example, in the United Kingdom, silence is observed on Remembrance Sunday, and London's quiet city ambiance is used. This is to reassure the listener that the station is still on-air, but primarily to prevent silence detection systems at transmitters from automatically starting backup tapes of music (designed to be broadcast in the case of transmission link failure). Sumber: http://en.wikipedia.org/wiki/Comfort_noise ….. Diunduh 6/4/2012

    47. BACKGROUND NOISE In acoustics and specifically in acoustical engineering, background noise or ambient noise is any sound other than the sound being monitored(primary sound). Background noise is a form of noise pollution or interference. Background noise is an important concept in setting noise regulations. Examples of background noises are environmental noises such as waves, traffic noise, alarms, people talking, bioacoustic noise from animals or birds and mechanical noise from devices such as refrigerators or air conditioning, power supplies or motors. The prevention or reduction of background noise is important in the field of active noise control. It is an important consideration with the use of ultrasound (e.g. for medical diagnosis or imaging), sonar and sound reproduction. In astronomy, background noise or cosmic background radiation is electromagnetic radiation from the sky with no discernible source. In information architecture, irrelevant, duplicate or incorrect information may be called background noise. In physics and telecommunication, background signal noise can be detrimental or in some cases beneficial. The study of avoiding, reducing or using signal noise is information theory. In telephony, artificial comfort noise is used as a substitute for natural background noise, to fill in artificial silence created by discontinuous transmission systems using voice activity detection. Background noise cam also affect concentration Sumber: http://en.wikipedia.org/wiki/Background_noise ….. Diunduh 6/4/2012

    48. NOISE POLLUTION Noise pollution is excessive, displeasing human, animal, or machine-created environmental noise that disrupts the activity or balance of human or animal life. The word noise may be from the Latin word nauseas, metaphorically meaning disgust or discomfort. The source of most outdoor noise worldwide is mainly construction and transportation systems, including motor vehicle noise, aircraft noise, and rail noise. Poor urban planning may give rise to noise pollution, since side-by-side industrial and residential buildings can result in noise pollution in the residential area. Human health Noise health effects describe problems in both health and behavior. Unwanted sound (noise) can damage physiological and psychological health. Noise pollution can cause annoyance and aggression, hypertension, high stress levels, tinnitus, hearing loss, sleep disturbances, and other harmful effects. Furthermore, stress and hypertension are the leading causes to health problems, whereas tinnitus can lead to forgetfulness, severe depression and at times panic attacks. Chronic exposure to noise may cause noise-induced hearing loss. Older males exposed to significant occupational noise demonstrate significantly reduced hearing sensitivity than their non-exposed peers, though differences in hearing sensitivity decrease with time and the two groups are indistinguishable by age 79. A comparison of Maaban tribesmen, who were insignificantly exposed to transportation or industrial noise, to a typical U.S. population showed that chronic exposure to moderately high levels of environmental noise contributes to hearing loss. High noise levels can contribute to cardiovascular effects and exposure to moderately high levels during a single eight hour period causes a statistical rise in blood pressure of five to ten points and an increase in stress and vasoconstriction leading to the increased blood pressure noted above as well as to increased incidence of coronary artery disease. Noise pollution is also a cause of annoyance. A study by Spanish researchers found that in urban areas households are willing to pay approximately four Euros per decibel per year for noise reduction. Sumber: http://en.wikipedia.org/wiki/Noise_pollution….. Diunduh 6/4/2012

    49. HEALTH EFFECTS FROM NOISE Noise health effects are the health consequences of elevated sound levels. Elevated workplace or other noise can cause hearing impairment, hypertension, ischemic heart disease, annoyance and sleep disturbance. Changes in the immune system and birth defects have been attributed to noise exposure. Although some presbycusis may occur naturally with age, in many developed nations the cumulative impact of noise is sufficient to impair the hearing of a large fraction of the population over the course of a lifetime. Noise exposure has also been known to induce tinnitus, hypertension, vasoconstriction and other cardiovascular impacts. Beyond these effects, elevated noise levels can create stress, increase workplace accident rates, and stimulate aggression and other anti-social behaviors. The most significant causes are vehicle and aircraft noise, prolonged exposure to loud music, and industrial noise. Road traffic causes almost 80% of the noise annoyances in Norway. There may be psychological definitions of noise as well. Firecrackers may upset some animals or noise-traumatized individuals. The most common noise traumatized persons are those exposed to military conflicts, but often loud groups of people can trigger complaints and other behaviors about noise. The social costs of traffic noise in EU22 are over €40 billion per year, and passenger cars and lorries (trucks) are responsible for bulk of costs. Traffic noise alone is harming the health of almost every third person in the WHO European Region. One in five Europeans is regularly exposed to sound levels at night that could significantly damage health. Sumber: http://en.wikipedia.org/wiki/Health_effects_from_noise….. Diunduh 6/4/2012

    50. NOISE CONTROL Noise control is an active or passive means of reducing sound emissions, often incentivised by personal comfort, environmental considerations or legal compliance. Practical and efficient noise control is wholly reliant on an accurate diagnosis of what is causing the noise, which first involves finding the source of noise. Once the source of noise has been found, the focus is reducing the noise at source by engineering means. The most common noise sources can be divided into aerodynamic (fans, pneumatics, combustion, etc) and mechanical (impacts, friction, etc). Effective noise control focuses on reducing the noise from these sources as close to the source as possible. Noise control for aerodynamic sources include quiet air nozzles, pneumatic silencers and quiet fan technology. In architectural acoustics and environmental acoustics, noise control refers to the set of practices employed for noise mitigation. Within architectural acoustics these practices include: interior sound reverberation reduction, inter-room noise transfer mitigation and exterior building skin augmentation. “More specific architectural noise control methods include the installation of thicker and/ or double-glazed windows,” acoustical gypsum, ceiling tiles, ceiling panels, carpet and draperies. In the field of environmental sound, common noise control practices include: design of noise barriers, development and enforcement of noise abatement legal codes and urban design. Types of noise control There are four basic principles of noise control: Sound insulation: prevent the transmission of noise by the introduction of a mass barrier. Common materials have high-density properties such as brick, thick glass, concrete, metal etc. Sound absorption: a porous material which acts as a ‘noise sponge’ by converting the sound energy into heat within the material. Common sound absorption materials include decoupled lead-based tiles, open cell foams and fiberglass Vibration damping: applicable for large vibrating surfaces. The damping mechanism works by extracting the vibration energy from the thin sheet and dissipating it as heat. A common material is sound deadened steel. Vibration isolation: prevents transmission of vibration energy from a source to a receiver by introducing a flexible element or a physical break. Common vibration isolators are springs, rubber mounts, cork etc. Sumber: http://en.wikipedia.org/wiki/Noise_control….. Diunduh 6/4/2012