340 likes | 429 Views
Visualise conservation. 1. Colour -> BLOSUM62. EMBO Workshop, Cape Town, 2014. Reduce redundancy. 1. Edit-> Remove Redundancy. 2. PICK “80%”. EMBO Workshop, Cape Town, 2014. 1. Edit-> Remove Empty Columns. EMBO Workshop, Cape Town, 2014. Define boundaries.
E N D
Visualise conservation 1. Colour -> BLOSUM62 EMBO Workshop, Cape Town, 2014
Reduce redundancy 1. Edit-> Remove Redundancy 2. PICK “80%”
1. Edit-> Remove Empty Columns EMBO Workshop, Cape Town, 2014
Define boundaries EMBO Workshop, Cape Town, 2014
Define boundaries 1. Colour -> Hydrophobicity EMBO Workshop, Cape Town, 2014
EEVTES ER 2KX7 model 1 TUM, January 2013
Trim alignment 1. CLICK on residue number bar to select column 2. Edit -> Remove right EMBO Workshop, Cape Town, 2014
Trim alignment 1. CLICK on residue number bar to select column 2. Edit -> Remove left EMBO Workshop, Cape Town, 2014
Save SEED alignment 1. File -> Save as “RcsD-ABL-SEED-ali.fasta” EMBO Workshop, Cape Town, 2014
Create HMM and run against database(s) 1. CLICK on Start EMBO Workshop, Cape Town, 2014
Create HMM and run against database(s) 1. CLICK on Choose File 2. Choose RcsD-ABL-SEED-ali.fasta EMBO Workshop, Cape Town, 2014
First run against RP75 to see if anything has changed 1. CLICK on rp75 EMBO Workshop, Cape Town, 2014
First run against RP75 to see if anything has changed NOW BEFORE
Now we run against UniProtKB EMBO Workshop, Cape Town, 2014
Check Scores EMBO Workshop, Cape Town, 2014
Check Low Scores EMBO Workshop, Cape Town, 2014
Define significance threshold EMBO Workshop, Cape Town, 2014
Check taxonomic distribution EMBO Workshop, Cape Town, 2014
Check taxonomic distribution EMBO Workshop, Cape Town, 2014
Save HMM EMBO Workshop, Cape Town, 2014
Job done? EMBO Workshop, Cape Town, 2014
Pick a target region 2KX7 TUM, January 2013 Schmöe et al. Structure 2011 EMBO Workshop, Cape Town, 2014
Pick a target region RcsD_ABL (PF16359) 2KX7 TUM, January 2013 Schmöe et al. Structure 2011 EMBO Workshop, Cape Town, 2014
Pick a target region RcsD_ABL (PF16359) 2KX7 TUM, January 2013 Schmöe et al. Structure 2011 EMBO Workshop, Cape Town, 2014
Job done? 2KX7 2AYY Schmöe et al. Structure 2011 EMBO Workshop, Cape Town, 2014
Job done? EMBO Workshop, Cape Town, 2014
Exercise Run the UNIPROT ID: Q820A8 with the hmmer website (2 iterations) and observe results EMBO Workshop, Cape Town, 2014
Exercise Run the UNIPROT ID: Q820A8 with the hmmer website (2 iterations) and observe results Run the Q820A8-PASTA-domain.fasta with the hmmer website (2 iterations) and observe results EMBO Workshop, Cape Town, 2014
Exercise Run the UNIPROT ID: Q820A8 with the hmmer website (2 iterations) and observe results Run the this portion of the Q820A8 sequence VTLSDYSGISYDNAVSRLIALGIPESQIKRVDEESDKVEKDTVISQEPASGTAVDPKNDTITLHVSK with the hmmer website (2 iterations) and observe results EMBO Workshop, Cape Town, 2014
Acknowledgements Rob Finn (Protein Family Team Leader) The Pfam Team: Penny Coggill Ruth Eberhardt JainaMistry John Tate IliasLavidas Alex Bateman (Protein sequence resources cluster) Sean Eddy -> HMMER3 (Janelia Farm) Erik Sonnhammer (Stockholm University) All organisers of the EMBO course, trainers and trainees EMBO Workshop, Cape Town, 2014