statistik peternakan n.
Download
Skip this Video
Loading SlideShow in 5 Seconds..
STATISTIK PETERNAKAN PowerPoint Presentation
Download Presentation
STATISTIK PETERNAKAN

Loading in 2 Seconds...

play fullscreen
1 / 67

STATISTIK PETERNAKAN - PowerPoint PPT Presentation


  • 306 Views
  • Uploaded on

STATISTIK PETERNAKAN. Direktorat STPHP. Direktorat Industri. Direktorat SP2K. Deputi Bidang Statistik Produksi. Subdirektorat Statistik Peternakan. Subdirektorat Statistik Perikanan. Subdirektorat Statistik Kehutanan. Seksi Penyiapan Kegiatan Statisitik Peternakan.

loader
I am the owner, or an agent authorized to act on behalf of the owner, of the copyrighted work described.
capcha
Download Presentation

PowerPoint Slideshow about 'STATISTIK PETERNAKAN' - amy-weeks


An Image/Link below is provided (as is) to download presentation

Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author.While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server.


- - - - - - - - - - - - - - - - - - - - - - - - - - E N D - - - - - - - - - - - - - - - - - - - - - - - - - -
Presentation Transcript
slide2

Direktorat STPHP

Direktorat Industri

Direktorat SP2K

DeputiBidangStatistikProduksi

Subdirektorat Statistik Peternakan

Subdirektorat Statistik Perikanan

Subdirektorat Statistik Kehutanan

Seksi Penyiapan Kegiatan Statisitik Peternakan

Seksi Pengolahan Statistik Peternakan

Seksi Evaluasi dan Pelaporan Staitistik Peternakan

DIREKTORAT SP2K

slide3

Kabag TU

KepalaBidangStstistikProduksi

Kepala BPS Provinsi

KepalaSeksiStatistikPertanian

Kepala Seksi Statistik Industri

Kepala Seksi Statistik Pertambangan Energi dan Konstruksi

DIREKTORAT SP2K

latar belakang
LATAR BELAKANG
  • Subsektor peternakan merupakan salah satu subsektor yang memberikan konstribusi pada perekonomian nasional serta mampu menyerap tenaga kerja, sehingga dapat diandalkan dalam upaya perbaikan perekonomian nasional
  • Subsektor peternakan merupakan secara langsung akan meningkatkan status gizi masyarakat, khususnya untuk pemenuhan kalori dan protein hewani
  • Pemenuhan konsumsi masyarakat atas kalori dan protein hewani akan meningkatkan kualitas sumber daya manusia (SDM)
slide5

Peranan data dan informasisangat diperlukan sebagai dasar perencanaan dan pembangunan. Sesuai dengan UU RI tahun 2006 tentang Sistem Perencanaan Pembangunan Nasional (SPPN) telah ditetapkan bahwa kebijakan perencanaan pembangunan didasarkan pada data dan informasi yang akurat dan dapat dipertanggungjawabkan.

  • Pemenuhan data peternakan secara rutin setiap tahun dilakukan BPS melalaui pendekatan perusahaan, RPH, dan keurmaster.
slide6

Pengumpulan data perusahaan peternakan bertujuan untuk memperoleh data struktur usaha peternakan.

  • Pengumpulan data melalui RPH dan keurmaster untuk memperoleh data produksi hasil pemotongan ternak
  • Pengumpulan data rumah tangga dilakukan melalui sensus dan survei.Sensus peternian menghasilkan jumlah rumah tangga dan populasi ternak yang digunakan sebagai benchmark survei-survei peternakan berikutnya.
slide7

Pengumpulan data melalui survei tergantung kebutuhan dan biaya yang tersedia. Survei peternakan yang telah dilakukan adalah Survei Rumah Tangga Peternakan Nasional (SPN, 2006-2008) dan Estimasi Populasi Ternak (EPT, sejak 2010) yang menghasilkan parameter mutasi ternak dan produktivitas ternak. Parameter mutasi tersebut digunakan untuk memperkirakan populasi ternak dari rumah tangga pada waktu yang akan datang

  • Hasil pengumpulan data perusahaan dan dipadukan dengan hasil SPN/EPT akan memperoleh data peternakan (populasi) secara menyeluruh dan lengkap.
landasan hukum
LANDASAN HUKUM
  • UU No 16 tahun 1997 tentang Statistik
  • PP RI No 51 tahun 1999 tentang Penyelenggaraan Statistik
  • Perpres No. 86 Tahun 2007 tentang BPS
tujuan
TUJUAN
  • Mendapatkan populasi, produksi dan struktur ongkos usaha peternakan yang dilakukan oleh perusahaan peternakan
  • Mendapatkan produksi hasil pemotongan ternak dari RPH dan keurmaster
  • Mendapatkan estimasi populasi dan produksi yang diusahakan rumah tangga di wilayah
ruang lingkup dan cakupan
RUANG LINGKUP DAN CAKUPAN
  • Pengumpulan data perusahaan peternakandan pemotongan ternak dari RPH keurmaster dilaksanakan di seluruh wilayah negara RI
  • Perusahaan peternakan yang dicakup adalah perusahaan peternakan berbadan hukum yang melakukan kegiatan usaha pembibitan dan budidaya ternak
  • RPH yang dicakup adalah seluruh RPH baik milik pemerintah maupun swasta
  • Keurmaster yang dicakup adalah keurmaster yang tidak bertugas di RPH
petugas
PETUGAS
  • Petugas lapangan yang terlibat dalam pengumpulan data perusahaan peternakan, RPH, dan Keurmaster adalah KSK dan atau Staf BPS Propinsi/Kab?kota yang diberi tugas
jenis dokumen 1
JENIS DOKUMEN (1)
  • Daftar-LTT : digunakan untuk mengumpulkan data perusahaan yang mengusahakan ternak besar (sapi potong, kerbau, kuda) dan ternak kecil (kambing, domba, dan babi)
  • Daftar-LTU : digunakan untuk mengumpulkan data perusahaan yang mengusahakan unggas (ayam pedaging, ayam petelur, dan unggas lainnya)
  • Daftar-LTS : digunakan untuk mengumpulkan data perusahaan sapi perah
jenis dokumen 2
JENIS DOKUMEN (2)
  • Daftar-RPH : digunakan untuk mengumpulkan data pemotongan ternak dari RPH
  • Daftar-Keurmaster : digunakan untuk mengumpulkan data pemotongan ternak dari keurmaster yang tidak bertugas di RPH
metodologi 1
METODOLOGI (1)
  • Metode yang digunakanuntukmengumpulkan data perusahaanpeternakanadalahpencacahanlengkap (sensus)terhadapseluruhperusahaanpeternakan yang berbadanhukum (PT, CV, Firma, Koperasi, BUMN, Yayasan) baikusahapembibitanmaupunbudidayaternak.
  • Periode data yang dikumpulkantahunandenganreferensiwaktusetahun yang lalu.
metodologi 2
METODOLOGI (2)
  • Periodepengumpulan data pemotonganternak yang dikumpulkandari RPH dankeurmasteradalahtriwulanan.
  • Metodepengumpulan data RPH dankeurmasterdilakukandenganpencacahanlengkap di seluruh Indonesia denganmenggunakanduapendekatan, yaitu :

a. RPH, milikpemerintahmaupunswasta dg respondenadalahpetugas RPH setempatataukeurmaster yang bertugas di RPH tersebut

b. Keurmaster, yaituDinasPeternakan/Pemdasetempatkhususnya yang tidaklangsungmenangani/tidakbertugas di RPH

slide16

TAHAP KEGIATAN

  • Persiapan
  • Dalamtahapanpersiapankegiatan yang dilaksanakanadalahmelakukanpemutakhirandirektoriuntukmenentukanjumlahperusahaan, RPH dankeurmaster yang akandigunakansebagai target pencacahandanalokasidokumen.
  • Menambahkannamadanalamatperusahaan, RPH dankeurmaster yang baruberdiriataubaruditemui di lapangandanbelumtercantumdalamdirektorisertamenghapusnamadanalamat yang telahtutupatautidakadakegiatan
  • Selanjutnyadilakukan matching direktoridenganinstansiterkaitatausumber lain
slide17

Jumlah perusahaan hasil pemutakhiran direktori digunakan sebagai target pencacahan dan perkiraan pencetakan kuesioner.

  • Kuesioner pencacahan dan direktori hasil pemutakhiran ke BPS Propinsi untuk selanjutnya didistribusikan ke BPS Kabupaten/Kota.
  • Setiap perusahaan akan dikirimkan sebanyak 3 (tiga) set kuesioner.
  • Satu set untuk pertinggal di Perusahaan dan dua set untuk dikirim kembali ke BPS Propinsi melalui BPS kabupaten/Kota dan selanjutnya 1 (satu) dikirim ke BPS.
slide18

Pelaksanaan

  • Pengumpulan data dilakukanterhadapsemuaperusahaanpeternakan yang berbadanhukumdenganmengisikuesionersesuaicatatanadministrasi yang ada di perusahaandanataudenganmewancaraipenanggungjawabperusahaanpeternakan.
  • Pengumpulan data pemotonganternakdilakukansecaralengkapterhadapseluruh RPH dankeurmaster.
  • Daftar-RPHdiisidenganmenyalincatatanpemotonganternak di RPH ataumewancaraipengelola RPH/keurmaster yang bertugas di RPH.
  • SedangkanDaftar-Keurmasteruntuklaporanpemotonganternakdarikeurmaster yang tidakbertugas di RPH, diisidenganmenyalincatatanpemotonganternakdarikeurmastertersebut di seluruhwilayahtugasnya.
slide19

Target

Direktori:

  • Up Dating Direktori dilakukan secara rutin tiap tahun dengan menambah perusahaan yang baru dan menghapus perusahaan yang sudah tutup atau tidak aktif
  • Laporan direktori dan jumlah dokumen yang masuk menjadi target tahun berikutnya
  • Direktori dikirim ke BPS Propinsi bersamaan dengan pengiriman dokumen pencacahan
  • Dokumen dua tahun berturut-turut tidak masuk dan tidak ada keterangan akan dikeluarkan dari target tahun berikutnya
slide20

Data Peternakan

Data yang dikumpulkan:

  • - Populasi (mutasi ternak)
  • - Data Produksi (telur, susu, daging(karkas))
  • - Struktur usaha

Periode pengumpulan:

- Rutin Triwulanan dan Tahunan

- Sensus Tahun berakhiran 3

- Survei Kebutuhan dan biaya

- Struktur ongkos - Parameter

slide21

Pengumpulan Data

  • Unit Observasi:
  • - Rumah tangga Sensus dan survei
  • Perusahaan laporan Tahunan Perusahaan
  • RPH & Keurmaster Laporan Triwulanan
  • (Indikator produksi daging)
slide22

Metode Pengumpulan Data

Estimasi

Sensus

Populasi akhir

tahun t-1

Po

Br

%B

P0

Survei SPN + EPT

Dt

%D

P0

Survei SPN + EPT

Amt

Laporan pemotongan ternak

Et

Catatan administrasi

It

Catatan administrasi

Pop

Data

peternakan

Produksi

slide23

Parameter Populasi

Pt = Populasi ternak tahun ke-t

Pt dihasilkan dari sensus

Untuk tahun dimana tidak dilakukan sensus, maka Pt didapatkan dengan cara estimasi menggunakan parameter

P0 = Populasi ternak tahun ke-(t-1)  populasi ternak stok awal

Dt = Parameter kematian

Br = Parameter kelahiran/penetasan

Et = Ternak keluar dari suatu wilayah

It = Ternak masuk ke suatu wilayah

K = Karkas

slide24

Am = Parameter pemotongan

Parameter pemotongan di suatu wilayah adalah parameter pemotongan tercatat dan tidak tercatat yang terdiri dari:

1. Parameter pemotongan tercatat disuatu wilayah diperoleh dari RPH dan Keurmaster (lap. Triwulanan)

2. Parameter pemotongan tidak tercatat oleh rumah tangga diperoleh dari parameter SPN 2008 dan EPT

3. Parameter pemotongan tidak tercatat di luar rumah tangga perlu diperkirakan (studi khusus)

slide25

Parameter Produksi

  • Parameter produksi ternak meliputi:
  • Produktivitas ternak/ekor menggunakan ukuran rata-rata:
  • Produksi susu sapi perah/ekor/tahun (m)
  • Produksi telur/ekor/tahun (p)
  • [ayam buras, ayam ras petelur, itik, dan itik manila]
  • Proporsi betina produktif (BP):
  • Persentase jumlah ternak betina dewasa (SPN08) terhadap total ternak yang diusahakan rumah tangga

Produksi daging:

Populasi ternak (Pt) x (% K) x (Am)

Produksi susu:

Populasi sapi perah (Pt) x (%BP) x (m)

Produksi telur:

Populasi Unggas (Pt) x (%BP) x (p)

konsep definisi 1
KONSEP DEFINISI (1)
  • Perusahaan Peternakan adalah unit usaha yang mengusahakan ternaka baik untuk pembibitan maupun budidaya dengan badan hukum PT, CV, Firma, Koperasi, BUMN, atau Yayasan
  • Pembibitan Ternak adalah kegiatan pemeliharaan ternak dengan tujuan utama pembibitan/pengembangbiakan ternak
  • Budidaya Ternak adalah kegiatan pemeliharaan ternak dengan tujuan utama pembesaran/ penggemukan ternak.
slide28

KONSEP DEFINISI (2)

  • RumahTanggaPemeliharaTernakadalahrumahtangga yang salahsatuataulebihanggotanyamelakukanpemeliharaanternak, tanpamelihatjumlahternakdantujuanpemeliharaan.
  • Kematianadalahjumlahternak yang matikarenasakitataukecelakaansepertitertabarakkendaraan, terbenam, dimakanbinatangbuas, dandimusnahkan.
  • Matikarenadipotong/disembelihtidaktermasukdalamkategorimati, tetapitermasukkategoripemotongan.
  • Pengurangan lain adalahpenguranganternak yang disebabkanoleh:

- Ternak yang diberikankepadapihak lain sebagaibantuan, hibah

ataubagihasil.

- Penyerahankembaliternak yang dibagihasilkankepadapemilik.

- Ternak yang hilangkarenadicuriatausebab lain.

slide29

KONSEP DEFINISI (3)

  • Kelahiran/Penetasanadalahlahir/ menetashidup, yaituternak yang dilahirkan/ dieteaskanmenunjukkantanda-tandakehidupanantara lain: jantungberdenyut, bernafasdanbergerak. Kelahirantetapdicatat, walaupunpadasaatpencacahananakmaupuninduknyasudahtidakadalagi (karenadijual, dipotong,dll).
  • Penambahan lain adalahpenambahanternakselainpembelian dam kelahiran/penetasan, misalnya :

- ternak yang diterimadaripihak lain sebagaibantuan, hibah,

danbagihasil

- penerimaandaripengembalianternakbagihasil

  • Stokawaladalahjumlahternak yang dikuasaiolehrumahtanggapadasaatsetahun yang lalu (dihitungsatutahunmundurmulaidarisatuharisebelumpencacahan)
  • Siklusayamraspedagingadalahrentangwaktu yang dimulaidarisaat DOC (Day Old Chick) dibeli, dipelihara/digemukkan, dansampaiakhirnyadijual.
slide30

KONSEP DEFINISI (4)

  • RPH (Rumah Potong Hewan) adalah semua tempat pemotongan hewan atau ternakselain unggas, bagi konsumsi masyarakat yang mempunyai bangunan permanen atau semi permanen yang khusus digunakan untuk tempat pemotongan hewan/ternak yang telah ditetapkan oleh pemerintah sebagai Rumah Potong Hewan.
  • Keurmaster adalah tenaga paramedik pemerintah yang telah mengikuti pelatihan tentang uji daging, dan bertugas di Rumah Potong Hewan (RPH), serta ditunjuk oleh Dinas Peternakan/Dinas yang membidangi fungsi peternakan atas nama bupati/walikota yang selanjutnya memiliki kewenangan untuk melaksanakan uji daging.
slide31

KONSEP DEFINISI (5)

  • Tugas Keurmaster adalah sebagai berikut:
  • Pemeriksaan dokumen hewan, pengawasan perlakuan hewan saat penerimaan danpengistirahatan dan pemeriksaan kesehatan (Ante Mortem)
  • Pengawasan teknis penyembelihan, pengulitan, pengeluaran jeroan dan pemeriksaan Post Mortem
  • Pengawasan kebersihan ruang produksi, peralatan, higiene personal, penanganan karkas dan pelaporan
slide32

Permasalahan Direktori

  • Direktori ditunggu pasif (respon rate rendah)
  • Tidak terdaftar dalam direktori tapi beroperasi
  • Tercantum di direktori kenyataan tidak ada
  • Dokumen nihil tanpa keterangan (non respon, tidak ditemui,

tutup)

  • Dokumen masuk double
  • Dokumen masuk di luar cakupan (tidak sesuai dengan

konsep definisi)

slide33

Permasalahan Isian

  • Pengeluaran lebih besar dari pendapatan perusahaan
  • Stok akhir tahun sebelumnya tidak sama dengan stok awal tahun berikutnya untuk perusahaan peternakan
  • Nilai cenderung tidak mengalami perubahan dari tahun ke tahun
  • Tidak ada perbedaan yang signifikan antar RPH dalam satu kabupaten
  • Beberapa kabupaten tidak ada laporan pemotongan ternak baik RPH maupun Keurmaster
slide34

LAPORAN TAHUNAN PERUSAHAAN TERNAK BESAR DAN KECIL (DAFTAR-LTT)

  • Tujuan
  • Daftar-LTT digunakanuntukmendapatkanketeranganrincimengenaiperusahaanternakbesardankecil
  • Ternakbesarmeliputisapipotong, kerbaudankudasedangkanternakkecilmeliputikambing, dombadanbabi
  • Keterangan yang dikumpulkanadalah:
  • keteranganumumperusahaan,
  • jumlahpekerjadanpengeluaranuntukpekerja,
  • jumlahdanmutasiternak,
  • produksiternak,pendapatan lain, pengeluaran untuk sapronak
  • pemakaianbahanbakar,
  • Pembentukan modal selamasetahun.
slide35

LAPORAN TAHUNAN PERUSAHAAN TERNAK BESAR DAN KECIL (DAFTAR-LTT)

  • Satu daftar-LTT digunakan untuk mencacah satu perusahaan ternak besar dan kecil.
  • Perusahaan ternak besar dan kecil yang dicakup dalam survei ini adalah perusahaan yang berbadan hukum/usaha yaitu PT/CV, Firma, Koperasi, dan Yayasan.
slide36

LAPORAN TAHUNAN PERUSAHAAN TERNAK BESAR DAN KECIL (DAFTAR-LTT)

B. Daftar-LTT

Blok I : Keterangan Umum

Blok II : Jumlah Pekerja dan Pengeluaran untuk Pekerja

Blok III : Jumlah Ternak yang Diusahakan

Blok IV : Pendapatan/Penerimaan Usaha Peternakan Selama Tahun (t)

Blok V : Pemakaian Bahan Bakar, Pelumas, Listrik dan Air Selama tahun (t)

Blok VI : Pengeluaran untuk Pakan Ternak, Obat-obatan, dan lainnya

Blok VII : Pembentukan Modal Tetap, Penambahan, Pengurangan, dan Perbaikan Besar (000Rp)

Blok VIII : Catatan

slide37

LAPORAN TAHUNAN PERUSAHAAN PETERNAKAN UNGGAS (DAFTAR-LTU)

  • Tujuan
  • Daftar-LTU digunakan untuk mendapatkan keterangan rinci mengenai perusahaan peternakan unggas
  • Keterangan yang dikumpulkan adalah:
  • keterangan umum perusahaan
  • jumlah pekerja dan pengeluaran untuk pekerja,
  • mutasi unggas,
  • pemakaian bahan bakar,
  • pengeluaran sapronak
  • pembentukan modal
  • produksi dan pendapatan lain selama setahun.
slide38

LAPORAN TAHUNAN PERUSAHAAN PETERNAKAN UNGGAS (DAFTAR-LTU)

  • Satu daftar-LTU digunakan untuk mencacah satu perusahaan peternakan unggas.
  • Perusahaan unggas yang dicakup dalam survei ini adalah perusahaan yang berbadan hukum/usaha yaitu PT/CV, Firma, Koperasi, dan Yayasan.
slide39

LAPORAN TAHUNAN PERUSAHAAN PETERNAKAN UNGGAS (DAFTAR-LTU )

B. Daftar-LTU

Blok I : Keterangan Umum

Blok II : Jumlah Pekerja dan Pengeluaran untuk Pekerja

Blok III : Mutasi Unggas

Blok IV :Pemakaian Bahan Bakar, Pelumas, Listrik dan Air Selama tahun (t)

Blok V : Pengeluaran untuk pakan, Obat-obatan, dan lainnya Selama Tahun (t)

Blok VI : Pembentukan Modal tetap, Penambahan, Pengurangan dan Perbaikan Besar (000Rp)

Blok VII : Produksi dan Pendapatan lain selama tahun (t)

Blok VIII : Catatan

slide40

LAPORAN TAHUNAN PERUSAHAAN SAPI PERAH (DAFTAR-LTS)

  • Tujuan
  • Daftar-LTS digunakanuntukmendapatkanketeranganrincimengenaiperusahaanpeternakansapiperah
  • Keterangan yang dikumpulkanadalah:
  • keteranganumumperusahaan,
  • jumlahpekerjadanpengeluaranuntukpekerja,
  • jumlahdanmutasiternak,
  • pemakaianbahanbakar,
  • pengeluaranperusahaan,
  • inseminasibuatan (IB),
  • produksidanpenggunaanproduksisusu,
  • pembentukan modal tetapserta
  • keteranganproduksidanpemasaransususelamasetahun,
slide41

LAPORAN TAHUNAN PERUSAHAAN SAPI PERAH (DAFTAR-LTS)

  • Satudaftar-LTS digunakanuntukmencacahsatuperusahaanpeternakansapiperah
  • Perusahaan ternakbesardankecil yang dicakupdalamsurveiiniadalahperusahaan yang berbadanhukum/usahayaitu PT/CV, Firma, Koperasi, danYayasan.
slide42

LAPORAN TAHUNAN PERUSAHAAN SAPI PERAH (DAFTAR-LTS)

B. Daftar-LTS

Blok I : Keterangan Umum

Blok II : Jumlah Pekerja dan Pengeluaran untuk Pekerja

Blok III : Jumlah dan mutasi Ternak

Blok IV : Pemakaian Bahan Bakar, Pelumas, Listrik dan Air Selama tahun (t)

Blok V : Pengeluaran untuk pakan, Obat-obatan,

Blok VI : Inseminasi Buatan (IB) selama Tahun (t)

Blok VII : Pengeluaran lainnya selama tahun (t)

Blok VIII : Produksi dan pendapatan lain Selama tahun (t)

Blok IX : Penggunaan Produksi Susu Selama Tahun (t)

Blok X : Pembentukan Modal Tetap, penambahan, pengurangan dan Perbaikan Besar (000 Rp)

Blok XI : Keterangan Produksi dan Pemasaran Susu

Blok XII : Catatan

slide43

LAPORAN TRIWULANAN PEMOTONGAN TERNAK (DAFTAR-RPH)

  • Tujuan
  • Daftar-RPH digunakan untuk memperoleh data produksi ternak di Rumah Pemotongan Hewan yang dilaporkan setiap triwulan.
  • Data yang dicatat mencakup:
  • jumlah ternak yang dipotong,
  • keterangan asal ternak yang dipotong,
  • rata-rata berat ternak hidup dan produksi hasil pemotongan,
  • rata-rata harga ternak hidup
  • jumlah sapi dan kerbau betina yang dipotong menurut alasan pemotongan (Majir, Brucelossis)
  • Satudaftar-RPH digunakanuntukmencacahsatu RPH
  • Respondennya adalah petugas RPH setempat atau Keurmaster yang ditugaskan di RPH
slide44

LAPORAN TRIWULANAN PEMOTONGAN TERNAK (DAFTAR-RPH)

B. Daftar-RPH

Blok I : Keterangan Umum

Blok II : Jumlah Ternak yang Dipotong

Blok III : Keterangan Asal Ternak yang Dipotong

Blok IV : Rata-rata Berat Ternak Hidup dan Produksi hasil Pemotongan

Blok V : Rata-rata harga Ternak Hidup dan Produksi Hasil pemotongan

Blok VI : jumlah sapi dan Kerbau Betina yang Dipotong menurut alasan Pemotongan

Blok VII : Keterangan Responden

Blok VIII : Keterangan Petugas

Blok IX : Catatan

slide45

LAPORAN TRIWULANAN PEMOTONGAN TERNAK (DAFTAR-KEUMASTER)

  • Tujuan
  • Daftar-KEUMASTER digunakanuntukmendapatkan data produksiternak di luarRumahPemotonganHewan yang dilaporkansetiaptriwulankekeumaster, jagal, petugasdinaspeternakan yang tidakbertugas di RPHtetapimempunyaitugasuntukmencatatpemotonganternak.
  • Keterangan yang dikumpulkanadalah:
  • Jumlah ternak yang dipotong,
  • rata-rata beratternakhidupdanproduksihasilpemotongan,
  • rata-rata hargaternakhidupdanproduksihasilpemotonganserta
  • jumlahsapidankerbaubetina yang dipotongmenurutalasanpemotongan.
  • Satu daftar-KEUMASTER digunakan untuk mencatat keterangan dari satu keumaster
slide46

LAPORAN TRIWULANAN PEMOTONGAN TERNAK (DAFTAR-KEUMASTER)

B. Daftar-KEUMASTER

Blok I : Keterangan Umum

Blok II : Jumlah Ternak yang Dipotong

Blok III : Rata-rata berat ternak Hidup dan Produksi Hasil pemotongan

Blok IV : Rata-rata harga Ternak Hidup dan Produksi hasil Pemotongan

Blok V : Jumlah sapi dan Kerbau Betina yang dipotong menurut Alasan Pemotongan

Blok VI : Keterangan Responden

Blok VII : Keterangan Petugas

Blok VIII : Catatan

perusahaan peternakan

PENYAJIAN DATA

PERUSAHAAN PETERNAKAN
  • Media Diseminasi:

1. Publikasi Statistik Perusahaan Peternakan Sapi Perah

2. PublikasiStatistik Perusahaan PeternakanternakBesar & Kecil

3. PublikasiStatistik Perusahaan PeternakanUnggas

  • Judul Tabel Pokok Yang Disajikan :
  • Jumlah Perusahaan Peternakan ......... Menurut Provinsi

dan Kegiatan Utama.

  • Jumlah Pekerja Perusahaan ........... Menurut Provinsi Status Jumlah Ternak Betina Menurut Propinsi dan produktivitas.
  • Jumlah Stock Unggas Perusahaan Ternak Unggas Akhir Tahun Menurut Provinsi
  • Produksi dan Nilai Produksi Perusahaan .......... Menurut

Provinsi dan Jenis Produksi dll.

rph dan keurmaster

PENYAJIAN DATA

RPH dan KEURMASTER
  • Media Diseminasi : Publikasi Statistik PemotonganTernak
  • Data Pokok Yg Dihasilkan: Jumlah Ternak yang Dipotong & Produksi Hasil Pemotongan.
  • Tingkat Sajian : Provinsi
slide49

PENYAJIAN DATA

  • Angka Perusahaan Peternakan:
  • Populasi Wilayah =Populasi hasil SPN08 +
  • Populasi Perusahaan +
  • (Rumah tangga khusus. dll )
  • Angka Pemotongan Ternak:
  • Pemotongan Ternak Wilayah =
  • Pemotongan ternak dari RPH & Keur Master +
  • Pemotongan ternak hasil SPN08 yang tidak
  • dilaporkan/Tidak Tercatat +
  • Pemotongan ternak tidak tercatat di luar rumah tangga
slide50

Survei Peternakan Nasional (SPN)

BPS :

    • - Rumahtangga: SensusPertanian
    • - Perusahaan : Laporantahunan
    • - Pemotongan : Laporantriwulanandari RPH & Keurmaster

DirektoratJenderalPeternakan

HasilKompilasiberdasarkanlaporandari Tingkat Kabupaten/Kota

  • Harapan:
  • - Diperlukansuatusistempendataanpeternakan yang establish,
  • kontinyudansatuversi data (BPS, DitjenPeternakanbaik di pusatmaupundaerah)
  • Tujuan SPN:
  • Mendapatkanestimasi parameter populasidanproduksi
  • ternakmelaluisurveirumahtanggaPeternakan.
slide51

Survei Peternakan Nasional (SPN)

  • DibangunKerjasama BPS danDitjenPeternakantahun 2006- 2008:
  • MelakukanSurveiPeternakanNasional (SPN)
  • Tujuanmendapatkanestimasi parameter populasidanproduksi
  • ternak yang diusahakanolehrumahtangga.
  • Denganadanya SPN data peternakanmulaimasukdalamSistemPerstatistikanNasional
  • Sistemmulaidibangundenganmemanfaatkanhasil SPN08
  • Parameter populasidanproduksidigunakansampaidiperoleh
  • data yang lebihlengkapdari SPN08 yaitu ST2013
  • Kelemahan SPN08:
  • Surveihanyamenghasilkan parameter parameteruntukpenghitunganpopulasi
  • Populasiawaluntukmenggerakkan parameter tidakdidasarkanhasilSensus
  • Parameter hasilsurveisangattidakmewakiliuntukternak yang sebarannyatidakmerata
slide52

Formula Estimasi Populasi

Estimasi Populasi Ternak yang diusahakan rumah tangga dapat dihitung melalui pergerakan mutasi ternak selama satu tahun , dengan formula sbb :

Pt+1=Populasi ternak tahun ke-(t+1)

P t=Populasi Ternak Tahun ke-t (Populasi Ternak Stok Awal)

Sl= Parameter Penjualan

Am = Parameter Pemotongan

Dt = Parameter Kematian

Rd= Parameter Pengurangan Lain

By= Parameter Pembelian

Br= Parameter Kelahiran atau Penetasan

Ad= Parameter Penambahan Lain

angka parameter
Angka Parameter
  • Parameter Populasi Ternak menggunakan ukuran proporsi yang diambil dari mutasi ternak yang diusahakan Rumah Tangga selama setahun, yakni persentase setiap unsur mutasi ternak terhadap stok awal.
  • Kecuali Untuk Ayam Ras Pedaging Proporsi/persentase diambil dari setiap unsur Mutasi Terhadap DOC yang dibeli.
angka parameter1
Angka Parameter
  • Angka ini hanya menggambarkan parameter mutasi ternak yang diusahakan rumah tangga secara nasional.
  • Parameter kelahiran dan kematian hasil SPN08 dapat mewakili parameter kelahiran dan kematian di suatu wilayah.
  • Parameter pemotongan hasil SPN08 hanya menggambarkan pemotongan ternak oleh ruta, tidak mewakili parameter pemotongan di suatu wilayah.
  • Parameter penambahan dan pengurangan lain dari hasil SPN08 hanya yang terjadi dalam rumah tangga tidak dapat mewakili parameter wilayah.
slide56
Parameter pemotongan di suatu wilayah adalah parameter pemotongan tercatat dan tidak tercatat.
  • Parameter pemotongan tercatat di suatu wilayah diperoleh dari RPH dan Keurmaster. Sedangkan parameter pemotongantidaktercatatolehrumahtanggadapatterwakilioleh parameter pemotongantidaktercatathasil SPN08.
langkah penyempurnaan
Langkah Penyempurnaan

EPT (Estimasi Parameter PopulasiTernak)

  • Surveirumahtanggapeternakan yang dilakukanoleh BPS secararutinsetiaptahun
  • Tujuan EPT untukmendapatkankoreksiterhadap parameter hasil SPN padatahunberjalan (Adanyawabah, bencanaalamdll)

PendataanSapiPotong, Sapiperah, danKerbau (PSPK2011)

  • Kerjasama BPS denganDitjenPeternakandanKesehatanHewan
  • untukmendapatkanpopulasisapipotong, sapiperahdankerbaubaik yang diusahakanolehrumahtangga, perusahaanberbadanhukumdanlainnya.
  • Hasil PSPK merupakanpopulasiawal yang akandigunakan

sebagaibanch-mark dalamprogram swasembadadaging

langkah penyempurnaan1
Langkah Penyempurnaan
  • Sebagaibahankajiankedepandiperlukanpenyajian data strategissepertidaging, telurdansususetiapbulan
  • Data yang disajikantetapharusdijagakualitasnya, salahsatualat yang dapatdigunakanadalahsupply and used table (Konsumsi, Ekspor, Industridll)
tujuan1
Tujuan
  • Secara umum tujuan PSPK2011 adalah sebagai dukungan utama untuk Program Swasembada Daging Sapi danKerbau(PSDSK) 2010-2014. Adapun secara khusus tujuannya adalah sebagai berikut :
  • Memperoleh data populasi dasar (Po) untuk ternak sapi potong, sapi perah dan kerbau tahun 2011 dengan metode sensus.
  • Membangun data-base (by name, by address) peternak sapi potong, sapiperah,dankerbauyang lengkap, akurat, dan mutakhir sebagai dasar pemeliharaan data pada tahun-tahun berikutnya.
cakupan dan metodologi
Cakupan dan Metodologi
  • Metode pengumpulan data dibedakan menjadi dua, yaitu:
  • Pendataan Langsung (door to door) bagidesapotensiternaksapipotong, sapiperah, dankerbau
  • Snowbowlingbagidesa yang tidakpotensiternaksapipotong, sapiperah, dankerbau
  • SweepingPenyisiran bagidesa yang tidakadarumahtanggaternak
  • Penentuanapakahdesapotensiternaksapipotong, sapiperah, dankerbauberdasarkan data SensusPertanian 2003 (ST03) danSensusPenduduk (SP2010)
hasil p spk2011 populasi

1

2

3

HasilPSPK2011 (Populasi)

SapiPotong

14.805.053 ekor

SapiPerah

597.135 ekor

Kerbau

1.305.016 ekor

Badan Pusat Statistik

slide67

TERIMA KASIH

Badan Pusat Statistik