310 likes | 414 Views
Discover the significance of GM technology in plant adaptation and evolution, presented by Dr. Jeremy Pritchard. Explore examples from his research on gene function, localization, and transcriptomics, and the impact on plant physiology. Learn about salt tolerance mechanisms and bioinformatics in plant research. Gain insights into the evolutionary processes shaping plant genomes for better adaptation. Access slides and resources via email or website.
E N D
Plant adaptation to changing environments: A role for GM Dr Jeremy Pritchard @DrJPritchard
Ecology Organisms Cells Molecules
Molecules: Transcription and Translation DNA mRNA Protein
Population growth Climate change
Why Sequence Genomes? • Will eventually tell us what genes do • Leads to Medical Applications • Leads to Agricultural Applications • Tells us about evolution • Tell us how we develop • Tell us how we are different to cabbages, mice and chimps
Examples from my research • Knockouts What does a gene do? • Localisation Where is it expressed? • Transcriptomics How do genes respond? Must combine Molecular with Physiology
Knockout (loss of function) Coding region makes protein Turns on specific gene Gene Promoter
Knockout (loss of function) Coding region makes no or truncated protein Insertion
Reporter genes Remove coding region
Reporter genes Coding region makes fluorescent protein New coding region
Salt crosses membranes through protein ‘gates’ These gates control salt levels in xylem Salt Salt
ctgtcttctcactaaactccaaaacccaccggaaaaatgattacgtggcacgacttgtacaccgtcctcaccgccgtggtaccactttacgtagctatgattctttacggcaatatttcacgcctacggatccgtacagtggtggaagatattctcaccagaccagtgctccggcacaaccgcttcgtcgctatcttcgccgtccctctcctctccttccacttcatctccaccaacgatctgtcttctcactaaactccaaaacccaccggaaaaatgattacgtggcacgacttgtacaccgtcctcaccgccgtggtaccactttacgtagctatgattctttacggcaatatttcacgcctacggatccgtacagtggtggaagatattctcaccagaccagtgctccggcacaaccgcttcgtcgctatcttcgccgtccctctcctctccttccacttcatctccaccaacgat CHx21 DNA Sequence MSSGAPLNVTNPNYDIEESRFGKIVCYDQSLLFEKREQKGWESGSTLASSLPFFITQLFVANLSYRVLYYLTRPLYLPPFVAQILCGLLFSPSVLGNTRFIIAHVFPYRFTMVLETFANLALVYN Amino acid Sequence Computer says: it looks like a salt transporter
10µm Immunology- protein is detected in root endodermis
Is the computer right? Find out; make knockout mutants ctgtcttctc actaaactcc aaaacccacc ggaaaaatga ttacgtggca cgacttgtac accgtcctca ccgccgtggt accactttac gtagctatga ttct ttacg tggcaatatt atcacgccta cggatccgta cagtggtgga agatattctc accagaccag tgctccggca tcaaccgctt cgtcgctatc ttcgccgtcc ctctcctctc cttccacttc atctccacca acgatcctta cgccatgaat Insert extra sequence: This means stop – no protein is made
Bioinformatics • 5 similar sequences to CHX21 • In pairs on chromosome 1 & 2
CHX5 CHX14 CHX23 CHX8’ CHX13’ CHX21’ CHX8 CHX13 CHX21 1. Duplication 2. Translocation 3. Diversification CHX5 CHX14 CHX23 Chromosome 1 Chromosome 2
To this…………... Evolution in action From this…………... EVOLOTION ……………….a better adapted plant
Dr Jeremy Pritchard @DrJPritchard
Slides and other resources are available as PowerPoint Email me: J.Pritchard@bham.ac.uk or go to http://www.birmingham.ac.uk/schools/biosciences/outreach