Proteins structure and function
This presentation is the property of its rightful owner.
Sponsored Links
1 / 63

Proteins: Structure and Function PowerPoint PPT Presentation


  • 100 Views
  • Uploaded on
  • Presentation posted in: General

Proteins: Structure and Function. Proteins. Cellular Overview Functions Key Properties Core Topics Amino Acids: properties, classifications, pI Primary Structure, Secondary Structure, and Motifs Tertiary Structure Fibrous vs. Globular Quaternary Structure. Amazing Proteins: Function.

Download Presentation

Proteins: Structure and Function

An Image/Link below is provided (as is) to download presentation

Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author.While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server.


- - - - - - - - - - - - - - - - - - - - - - - - - - E N D - - - - - - - - - - - - - - - - - - - - - - - - - -

Presentation Transcript


Proteins structure and function

Proteins: Structure and Function


Proteins

Proteins

  • Cellular Overview

    • Functions

    • Key Properties

  • Core Topics

    • Amino Acids: properties, classifications, pI

    • Primary Structure, Secondary Structure, and Motifs

    • Tertiary Structure

      • Fibrous vs. Globular

    • Quaternary Structure


Amazing proteins function

Amazing Proteins: Function

  • The largest class of proteins, accelerate rates of reactions

  • Catalysts (Enzymes)

  • Transport & Storage

DNA Polymerase

CK2 Kinase

Catalase

Ovalbumin

Casein

Ion channels

Hemoglobin

Serum albumin


Amazing proteins function1

Amazing Proteins: Function

  • Structural

  • Generate Movement

Collagen

Keratin

Silk Fibroin

Actin

Myosin


Amazing proteins function2

Amazing Proteins: Function

  • Regulation of Metabolism and Gene Expression

  • Protection

Lac repressor

Insulin

Thrombin and Fibrinogen

Ricin

Venom Proteins

Immunoglobulin


Amazing proteins function3

Amazing Proteins: Function

  • Signaling and response (inter and intracellular)

Apoptosis

Membrane proteins

Signal transduction


Amazing proteins properties

Amazing Proteins: Properties

  • Biopolymers of amino acids

  • Contains a wide range of functional groups

  • Can interact with other proteins or other biological macromolecules to form complex assemblies

  • Some are rigid while others display limited flexibility


A amino acids protein building blocks

a-Amino Acids: Protein Building Blocks

R-group or side-chain

a-amino group

Carboxyl group

a-carbon


Amino acids are zwitterionic

Amino acids are zwitterionic

  • “Zwitter” = “hybrid” in German

  • Fully protonated forms will have specific pKa’s for the different ionizable protons

  • Amino acids are amphoteric (both acid and base)


Stereochemistry of amino acids

Stereochemistry of amino acids


Stereochemistry of amino acids aa

Stereochemistry of amino acids (AA)

  • AA’s synthesized in the lab are racemic mixtures. AA’s from nature are “L” isomers

  • These are all optically-active except for glycine (why?)


Synthesis of proteins

Synthesis of Proteins

+ H2O


Synthesis of proteins1

Synthesis of Proteins


Synthesis of proteins2

N-Terminal End

C-Terminal End

Synthesis of Proteins


Synthesis of proteins3

Synthesis of Proteins

=


Synthesis of proteins4

Synthesis of Proteins

=


Synthesis of proteins5

Synthesis of Proteins


Common amino acids

20 common amino acids make up the multitude of proteins we know of

COMMON AMINO ACIDS


Amino acids with aliphatic side chains

Amino Acids With Aliphatic Side Chains


Amino acids with aliphatic side chains1

Amino Acids With Aliphatic Side Chains


Amino acids with aliphatic side chains2

Amino Acids With Aliphatic Side Chains


Amino acids with aromatic side chains

Amino Acids With Aromatic Side Chains


Amino acids with aromatic side chains can be analyzed by uv spectroscopy

Amino Acids with Aromatic Side Chains Can Be Analyzed by UV Spectroscopy


Amino acids with hydroxyl side chains

Amino Acids With Hydroxyl Side Chains


Amino acid with a sulfhydryl side chain

Amino Acid with a Sulfhydryl Side Chain


Disulfide bond formation

Disulfide Bond Formation


Amino acids with basic side chains

Amino Acids With Basic Side Chains


Amino acids with acidic side chains and their amide derivatives

Amino Acids With Acidic Side Chains and Their Amide Derivatives


Proteins structure and function

There are some important uncommon amino acids we shall still encounter later on.


Ph and amino acids

pH and Amino Acids

Net charge: +1

Net charge: -1

Net charge: 0


Characteristics of acidic and basic amino acids

Basic amino acids

High pKa

Function as bases at physiological pH

Side chains with N

Acidic amino acids

Low pKa

Negatively charged at physiological pH

Side chains with –COOH

Predominantly in unprotonated form

Characteristics of Acidic and Basic Amino Acids


Protein structure

Protein Structure

We use different “levels” to fully describe the structure of a protein.


Primary structure

Primary Structure

  • Amino acid sequence

  • Standard: Left to Right means N to C-terminal

  • Eg. Insulin (AAA40590)

  • The info needed for further folding is contained in the 1o structure.

MAPWMHLLTVLALLALWGPNSVQAYSSQHLCGSNLVEALYMTCGRSGFYRPHDRRELEDLQVEQAELGLEAGGLQPSALEMILQKRGIVDQCCNNICTFNQLQNYCNVP


Secondary structure

Secondary Structure

  • The regular local structure based on the hydrogen bonding pattern of the polypeptide backbone

    • α helices

    • β strands (β sheets)

    • Turns and Loops

  • WHY will there be localized folding and twisting? Are all conformations possible?


Helix

α Helix

  • First proposed by Linus Pauling and Robert Corey in 1951.

  • 3.6 residues per turn, 1.5 Angstroms rise per residue

  • Residues face outward


Helix1

α Helix

  • α-helix is stabilized by H-bonding between CO and NH groups

  • Except for amino acid residues at the end of the α-helix, all main chain CO and NH are H-bonded


Helix representation

α Helix representation


Strand

β strand

  • Fully extended

  • β sheets are formed by linking 2 or more strands by H-bonding

  • Beta-sheet also proposed by Corey and Pauling in 1951.


Proteins structure and function

PARALLEL

ANTIPARALLEL


The beta turn

The Beta Turn

  • (aka beta bend, tight turn)

  • allows the peptide chain to reverse direction

  • carbonyl C of one residue is H-bonded to the amide proton of a residue three residues away

  • proline and glycine are prevalent in beta turns


Mixed sheets

Mixed β Sheets


Twisted sheets

Twisted β Sheets


Loops

 Loops


What determines the secondary structure

What Determines the Secondary Structure?

  • The amino acid sequence determines the secondary structure

  • The α helix can be regarded as the default conformation

    – Amino acids that favor α helices:

    Glu, Gln, Met, Ala, Leu

    – Amino acids that disrupt α helices:

    Val, Thr, Ile, Ser, Asx, Pro


What determines the secondary structure1

What Determines the Secondary Structure?

  • Branching at the β-carbon, such as in valine, destabilizes the α helix because of steric interactions

  • Ser, Asp, and Asn tend to disrupt α helices because their side chains compete for H-bonding with the main chain amide NH and carbonyl

  • Proline tends to disrupt both α helices and β sheets

  • Glycine readily fits in all structures thus it does not favor α helices in particular


Can the secondary structure be predicted

Can the Secondary Structure Be Predicted?

  • Predictions of secondary structure of proteins adopted by a sequence of six or fewer residues have proved to be 60 to 70% accurate

  • Many protein chemists have tried to predict structure based on sequence

    • Chou-Fasman: each amino acid is assigned a "propensity" for forming helices or sheets

    • Chou-Fasman is only modestly successful and doesn't predict how sheets and helices arrange

    • George Rose may be much closer to solving the problem. See Proteins 22, 81-99 (1995)


Proteins structure and function

Modeling protein folding with Linus (George Rose)


Tertiary structure

Tertiary Structure

  • The overall 3-D fold of the polypeptide chain

  • The amino acid sequence determines the tertiary structure (Christian Anfinsen)

  • The polypeptide chain folds so that its hydrophobic side chains are buried and its polar charged chains are on the surface

    • Exception : membrane proteins

    • Reverse : hydrophobic out, hydrophilic in

  • A single polypeptide chain may have several folding domains

  • Stabilized by H-bonding, LDF, noncovalent interactions, dipole interactions, ionic interactions, disulfide bonds


Fibrous and globular proteins

Fibrous and Globular Proteins


Fibrous proteins

Fibrous Proteins

  • Much or most of the polypeptide chain is organized approximately parallel to a single axis

  • Fibrous proteins are often mechanically strong

  • Fibrous proteins are usually insoluble

  • Usually play a structural role in nature


Examples of fibrous proteins

Examples of Fibrous Proteins

  • Alpha Keratin: hair, nails, claws, horns, beaks

  • Beta Keratin: silk fibers (alternating Gly-Ala-Ser)


Examples of fibrous proteins1

Examples of Fibrous Proteins

  • Collagen: connective tissue- tendons, cartilage, bones, teeth

    • Nearly one residue out of three is Gly

    • Proline content is unusually high

    • Unusual amino acids found: (4-hydroxyproline, 3-hydroxyproline , 5-hydroxylysine)

    • Special uncommon triple helix!


Globular proteins

Globular Proteins

  • Most polar residues face the outside of the protein and interact with solvent

  • Most hydrophobic residues face the interior of the protein and interact with each other

  • Packing of residues is close but empty spaces exist in the form of small cavities

  • Helices and sheets often pack in layers

  • Hydrophobic residues are sandwiched between the layers

  • Outside layers are covered with mostly polar residues that interact favorably with solvent


Proteins structure and function

An amphiphilic helix in flavodoxin:

A nonpolar helix in citrate synthase:

A polar helix in calmodulin:


Quaternary structures

Quaternary Structures

  • Spatial arrangement of subunits and the nature of their interactions. Can be hetero and/or homosubunits

  • Simplest example: dimer (e.g. insulin)

    ADVANTAGES of 4o Structures

    • Stability: reduction of surface to volume ratio

    • Genetic economy and efficiency

    • Bringing catalytic sites together

    • Cooperativity


Protein folding

Protein Folding

  • The largest favorable contribution to folding is the entropy term for the interaction of nonpolar residues with the solvent

  • CHAPERONES assist protein folding

    • to protect nascent proteins from the concentrated protein matrix in the cell and perhaps to accelerate slow steps


  • Login