1 / 59

Opioid Analgesics and Antagonists

Opioid Analgesics and Antagonists. Ed Bilsky, Ph.D. Department of Pharmacology University of New England. Phone 207.602.2707 E-mail: ebilsky@une.edu. Case 1

Download Presentation

Opioid Analgesics and Antagonists

An Image/Link below is provided (as is) to download presentation Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author. Content is provided to you AS IS for your information and personal use only. Download presentation by click this link. While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server. During download, if you can't get a presentation, the file might be deleted by the publisher.

E N D

Presentation Transcript


  1. Opioid Analgesics and Antagonists Ed Bilsky, Ph.D. Department of Pharmacology University of New England Phone 207.602.2707 E-mail: ebilsky@une.edu

  2. Case 1 A 33-year-old truck driver presented with left shoulder pain dating from a motor vehicle accident 4 years before. His pain was described as “constant” and “constricting,” with “stabbing electric, shock-like” characteristics. It had increased over the past 2 years to intensities between 7 and 10 out of 10 (0 = no pain, 10 = excruciating pain). He had undergone excision of the lateral end of the left clavicle and rotator cuff decompression 3 years earlier, receiving physiotherapy before and after surgery. He had also used heat and a machine providing transcutaneous electric nerve stimulation and had received intra-articular injections of anaesthetic agents and steroids. When first seen in the pain clinic he was taking, on average, one tablet of acetaminophen/codeine/ caffeine (300 mg/30 mg/15 mg) and one tablet of acetaminophen/oxycodone (325 mg/5 mg) 5 times daily. He also drank 10 cups of coffee daily, had been unable to sleep more than 3 hours in 24 for the last 2 years and was working night shifts. Apart from smoking a pack of cigarettes per day, the patient had no other risk factors for addiction, and he described having a supportive wife and 2 daughters. What modifications to his medication regimen and lifestyle might provide him with better pain management?

  3. Opium and Opioids: A Brief History • Among the remedies which it has pleased almighty God to give to man to relieve his sufferings, none is so universal and efficacious as opium… Sydenham, 1680 • Opium has been used and abused for thousands of years • the antidiarrheal actions were used to treat dysentery

  4. Opium and Opioids: A Brief History • In 1806, Sertürner isolated an alkaloid from opium which he called morphine (L. morpheus, god of dreams) • ushered in the field of alkaloid medicinal chemistry • A number of other alkaloids were subsequently isolated from opium • codeine, papaverine, thebaine, etc.

  5. Opium and Opioids: A Brief History • Problems with opioid addiction were recognized early on • development of hypodermic syringe/needle - Soldier’s disease • patent medicines • There has been a long history of trying to modify the chemical structure of morphine to decrease side-effects • heroin as a nonaddictive alternative to morphine!!! • synthetic agents such as methadone • mixed opioid agonists/antagonists • The field of opioid pharmacology has also been the source of major advances in scientific methodology and medicinal chemistry • development of radioligand binding assays in the early 1970s and the identification of opioid receptors • isolation of endogenous opioid peptides in 1975 • cloning of all three opioid receptors in the early 1990s

  6. Opioid Receptors • Currently, there are three cloned opioid receptors • mu, delta and kappa • Each receptor type has similarities and key differences with regard to the others • members of the G-protein coupled receptor family • tend to produce inhibitory effects on neurotransmission • distinct distributions in the CNS • Most of the currently available opioids work through the mu opioid receptor

  7. Mechanism of Action-Cellular • Opioid receptors are coupled to the Gi/Go class of G-protein coupled receptors • Opioid agonist administration leads to an inhibition of adenylyl cyclase and a decrease in cAMP formation • The downstream mediators of the opioid response include an opening of inwardly rectifying K+ channels and an inhibition of voltage-gated Ca2+ channels

  8. G-Protein Coupled Receptors

  9. Mechanism of Action-Systems Opioid analgesics can work at several levels: • Peripheral receptors • role in inflammatory pain states and hyperalgesia • Spinal cord • profound analgesia/anesthesia with spinal administration • Supraspinal sites • activation of descending pain control pathways • involvement of the limbic system

  10. Peripheral Sites of Action

  11. Peripheral Sites of Action Inflammatory tooth pain Fig. 1. Columns represent differences (mean ± SEM) in VAS scores (VAS) of patients receiving saline versus patients receiving morphine(VASsal - VASmor) in trial 1 (A), trial 2 (B), and trial 3 (C). In patients with inflammatory tooth pain (A), differences in VAS scores between the saline and morphine group are significantly different (P < 0.05, RM-ANOVA). In patients without inflammatory tooth pain (B) or with perineural morphine administration (C) differences in VAS scores are not significantly different Likar R, Koppert W, Blatnig H, Chiari F, Sittl R, Stein C, Schafer M. Efficacy of peripheral morphine analgesia in inflamed, non-inflamed and perineural tissue of dental surgery patients. J Pain Symptom Manage 2001 Apr;21(4):330-7 No inflammatory tooth pain Perineural morphine

  12. Spinal Analgesia • Opioid receptors are located on the primary afferent terminal • attenuates release of substance P and glutamate • High concentrations of opioid receptors are also seen postsynaptically in laminae I, II, V and X of the spinal cord • activation increases potassium conductance, thereby hyperpolarizing second order neurons • decreased GABA release www.hosppract.com/issues/2000/07/brook.htm

  13. Supraspinal Analgesia • Brainstem circuits may inhibit rostral movement of nociceptive information and activate descending pathways that alter nociceptive processing in the spinal cord • periaqueductal gray • rostral ventral medulla • Parts of the limbic system activated by opioids may alter the emotional response to painful stimuli • nucleus accumbens/ventral forebrain

  14. Endogenous Opioids • There are at least three families of endogenous opioid peptides • individual peptides derived from larger precursors • Each family has a unique anatomical distribution and pharmacological profile

  15. Endogenous Opioids • The precise role that these peptides play in the regulation of physiological functions is unclear • pain transmission • mood • eating/drinking behaviors • and many others

  16. Stimulation of Central Sites Produces Analgesia in Humans 0 Electrical Stimulation of PAG Beta-endorphin Surrounds PAG A. Basbaum Hosobuchi et al, 1977

  17. Mammalian Endogenous Opioid Peptides Precursor Endogenous peptide Amino acid sequence Pro-opiomelanocortin b-Endorphin YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE Pro-enkephalin [Met]enkephalin YGGFM [Leu]enkephalin YGGFL YGGFMRF YGGFMRGL Metorphamide YGGFMRRV-NH2 Pro-dynorphin Dynorphin A YGGFLRRIRPKLKWDNQ Dynorphin A(1-8) YGGFLRRI Dynorphin B YGGFLRRQFKVVT a-neoendorphin YGGFLRKYPK b-neoendorphin YGGFLRKYP Pro-nociceptin / OFQ Nociceptin FGGFTGARKSARKLANQ Pro-endomorphin* Endomorphin-1 YPWF-NH2 Endomorphin-2 YPFF-NH2 *Presumed to exist, awaiting discovery

  18. Main Effects of Opioids at Therapeutic Doses DesirableUndesirableMixed Desirability AnalgesiaNausea, vomitingSedation Relief of anxiety Urinary retention Euphoria Dysphoria Cough suppression Mental clouding  Bowel motility Tolerance Drug dependence syndrome Respiratory depression Postoperative ileus Biliary spasm

  19. Analgesic Effects • Pain is a complex phenomenon that has both sensory and emotional components • Opioid analgesics can inhibit both the transmission of the sensory signals to higher CNS centers and the affective aspects of the experience • Many patients report that they feel the pain, yet it is not necessarily aversive • The higher efficacy compounds have a broad spectrum of activity

  20. Tolerance • Tolerance refers to the phenomenon in which previous exposure to a drug results in a diminution of an effect or the need for a higher dose to maintain an effect • Tolerance to opioid analgesics has been reported in both animal models and clinical situations • Tolerance to the adverse effects of opioids may also occur, though the rate and degree of tolerance varies for each effect and each patient

  21. Mechanisms of Tolerance • There have been a number of hypotheses put forward to explain the development of tolerance • receptor down regulation • receptor internalization • receptor/G-protein desensitization • other compensatory adaptations • My laboratory, and others, are trying to develop opioid analgesics that produce less tolerance, or adjunct agents that limit the development of tolerance

  22. Models of Tolerance Naive Tolerant 100 % Animals Showing Effect 50 0 1 3 10 Log Dose (mg/kg)

  23. Management of Tolerance • The development of tolerance can usually be managed effectively by: • considering a differential diagnosis for the loss of analgesia (e.g., progression of disease) • increasing the dose of opioid analgesic • switching to another opioid analgesic with greater efficacy • adding alternative pain management strategies

  24. Physical Dependence • Prolonged exposure to an opioid agonist can produce adaptations at the cellular and systems levels which oppose the drug effect • the patient has become physically dependent on the drug • physical dependence does not equal addiction!!! • The discontinuation or sudden reduction in drug levels, or the administration of an antagonist, can lead to a withdrawal syndrome

  25. Symptoms and Signs of Opioid Withdrawal SymptomsSigns restlessness pupillary dilation irritability sweating increased sensitivity to pain tachycardia nausea vomiting abdominal cramps diarrhea myalgia hypertension dysphoria yawning insominia fever anxiety rhinorrhea drug craving piloerection

  26. Physical Dependence • Overt opioid withdrawal symptoms can usually be managed effectively: • reinstatement of a low dose of the opioid • gradual tapering of opioid agonist • use of adjunct agents to ease withdrawal symptoms (e.g., clonidine) • Subtle episodic withdrawal symptoms may, however, complicate pain management • use of longer acting agents over short acting opioids

  27. Barriers to Adequate Pain Control • Fear of Addiction "When we surveyed the parents of children dying with cancer, we asked them what the major concern was about their child receiving narcotics. It was that 'my child will grow up to be an addict,' and these were clearly children that were going to die." Kathleen Foley, M.D. (Dahl et al., 1986)

  28. PAINKILLER TEARS THROUGH MAINE OxyContin Addicts, Crime Wave Linked LEWISTON, Maine - The crowbar rained on Dorothy Treadwell.  Once.  Twice.  Twenty times.  The tiny orange pills her assailant sought scattered to the ground. Treadwell, 48, struggled to rise.  She gripped a radiator.  Again came the crowbar.  The blow left her pinky hanging by a scrap of tendon.  She ran bloodied into the street. Her neighborhood by the railroad tracks near downtown here is a poor collection of rickety wood houses aside metal silos of small-time factories.  But such savagery is rare.  The assailant, said Treadwell, was Cleve Herrick, her live-in lover.  He is a raging OxyContin addict, she said, desperate - like hundreds of others in Maine - to obtain the addictive prescription painkiller, often called “poor man's heroin.” “It was pretty bad for this area.  I mean, a crowbar?” recalled James Theiss, a Lewiston police detective on the case in which Herrick is now charged with two counts of aggravated assault. OxyContin, a remarkably effective painkiller, is shredding the social fabric of parts of Maine, creating a Wild West-like anarchy in many communities, according to dozens of interviews with state officials, doctors, and police.

  29. If you have been prescribed OxyContin, you may be entitled to compensation Please review the information on our site and contact us for immediate legal assistance. OxyContin, marketed by Purdue Pharma L.P., has been linked to addiction, suffering and death of patients using this prescription painkiller. OxyContin, approved by the FDA in 1995, is a time-released form of oxycodone, an opium derivative, which is the same active ingredient in Percodan and Percocet. OxyContin is intended for use by terminal cancer patients and chronic pain sufferers. It has been linked to at least 120 overdose deaths nationwide. It has been alleged that Purdue Pharma L.P. has marketed the drug excessively without stressing its addictive nature. Doctors and pharmacists say the manufacturer of OxyContin promoted the benefits of the drug without providing enough warning about the serious side effects of addiction. It has also been alleged Purdue Pharma L.P. made misrepresentations and failed to sufficiently warn individuals regarding appropriate use and risks of OxyContin. It has been reported that OxyContin's sales exceeded $1 billion in the U.S. in 2000.

  30. Addiction Liability • Studies in the 1920s and 1950s were influential in setting opioid analgesia policy in the later part of the 20th century • chronic opioid therapy leads to addiction • Kathleen Foley quote • These studies had methodological flaws and more recent reports have suggested that the risk of iatrogenic opioid addiction is very low • the incidence of addiction in chronic pain patients parallels the lifetime prevalence rates in the general population (Fishbain et al., 1992)

  31. Respiratory Depression • Respiratory depression is the most life-threatening of the side-effects associated with opioid analgesics • major cause of fatal opioid overdoses • Opioid receptors are located on chemoreceptors and ventral respiratory group neurons in the medulla • diminished sensitivity to changes in O2 and CO2 levels • changes in tidal volume and frequency of respiration

  32. Respiratory Depression • Respiratory depression is typically not a problem if guidelines are followed • more common with bolus dosing in naïve individuals • some of the fentanyl analogues can produce chest wall rigidity which interferes with the muscles of breathing • partial agonists typically produce less depression • Special clinical populations include patients with asthma, emphysema, COPD, cor pulmonale and increased intracranial pressure • naloxone can reverse the depressant effects of most opioids

  33. Effects on Mood/Cognition • Analgesic doses of most opioids produces relief from anxiety and a floating, dream-like state • majority of people report euphoric feelings, though some patients find the experience dysphoric • kappa opioid agonists appear to produce dysphoria • Drowsiness and clouding of mentation are frequently reported effects of opioids • elderly more susceptible to these effects • Chronic use of opioids results in little, if any, impairment of cognition or motor skills (e.g., driving skills)

  34. Nausea and Vomiting • Opioids stimulate the chemoreceptor trigger zone producing nausea and vomiting • tolerance typically occurs to repeated dosing • Ambulation exacerbates the nausea and vomiting • Administration of antiemetic drugs can decrease these side-effects • Orthostatic hypotension is also possible with analgesic doses of opioids

  35. Constipation • One of the biggest concerns with chronic opioid administration is severe constipation • occurs in almost all patients receiving chronic opioids • In many cases, constipation is the primary reason for the patient discontinuing opioid therapy • Constipation can be partially managed by using laxatives • development of opioid antagonists that do not cross the blood-brain barrier

  36. Antitussive Effects • Opioid analgesics can strongly suppress the cough reflex • exact mechanisms are unknown • Weaker opioids such as codeine are formulated for this purpose • accumulation of secretions in the lungs can lead to airway obstruction • Many OTC cough suppressants contain the opioid-like molecule dextromethorphan • decreased side-effects compared to codeine

  37. Cardiovascular Effects • Most opioids have no significant direct effect on the heart • morphine is the drug of choice for relieving pain from cardiac ischemia • possible cardioprotective effects in ischemic models • Hypotension may occur following opioid administration • histamine release and depressant effects in the vasomotor systems of the brainstem

  38. Other Opioid Effects • Constriction of biliary smooth muscle, resulting in biliary colic • Renal function is depressed • antidiuretic effect mediated through mu receptors • increased sphincter tone may produce urinary retention • Prolongation of labor • Morphine versus meperidine • Flushing of the skin, sweating and itching • Modulation of immune function

  39. Drug Interactions • Many other CNS depressants can act in an additive or synergistic manner with opioid analgesics • benzodiazepines • barbiturates • alcohol • antipsychotics • MAO inhibitors with opioids may produce hyperpyrexic coma and hypertension • especially with meperidine • Stimulants have sometimes been used to counteract the CNS depressant effects of opioids

  40. Pain Management Techniques

  41. Pain Management Techniques

  42. Choosing an Appropriate Opioid • Assessment of the pain • severity and type of pain • Pharmacokinetic considerations • route of administration • duration of action • Pharmacodynamic considerations • differences between drugs, novel effects • Individual patient factors • age, sex, genetic factors • disease states (renal or liver disease) • concurrent drug therapy • psychosocial factors

  43. WHO Analgesic Ladder

  44. Morphine • Prototypical mu opioid agonist • indicated for moderate to severe pain • Multiple preparations available • parenteral • oral and sustained release (MS Contin) • rectal • M3ß- and M6ß-glucoronides are primary metabolites • may contribute to analgesic effects (M6ß) and side-effects (M3ß) • lower dosing in geriatric patients (smaller Vd and  renal function) • Morphine produces histamine release • bronchoconstriction and vasodilation • patients with reduced blood volume are more sensitive to the vasodilatory effects of morphine

  45. Codeine • Codeine is a weak opioid analgesic • has limited affinity for opioid receptors • considered a prodrug • Needs to be demethylated to morphine • approximately 10% of Caucasians lack the cytochrome P450 isozyme (CYP 2D6) • these patients will get no relief from even high doses of codeine

  46. Methadone • Full opioid agonist • efficacy similar to morphine • good oral bioavailability • long half-life and duration of action • The compound has antagonist actions at the NMDA receptor complex • decreased development of tolerance and physical dependence? • role in treatment of neuropathic pain? • Used in the treatment of heroin addiction and managing opioid withdrawal

  47. Fentanyl and Analogues • Relatively selective mu opioid agonists • typically more potent than morphine • shorter duration of action (e.g., remifentanil) • high efficacy compounds • Fentanyl can be given by various routes • transdermal patch • fentanyl lozenge (lollipop) • Muscular rigidity more pronounced with this class of compounds compared to morphine

  48. Meperidine • Moderate efficacy opioid agonist • used for moderate pain • The compound has antimuscarinic effects • cardiovascular effects possible • limited constriction of the pupil • Accumulation of normeperidine(metabolite) can produce seizures • caution with high doses and in patients with renal insufficiency • No longer recommended for chronic pain management • Do not use with MAO inhibitors (serotonin syndrome) • Other notes • Applications in labor and delivery??? • decreased urinary retention and constipation versus morphine??? • used to treat post-anesthetic shivering

More Related