Mapping
Download
1 / 83

Mapping - PowerPoint PPT Presentation


  • 364 Views
  • Updated On :

Mapping. Nucleic Acids and Proteins. Mapping. Restriction Mapping Open Reading Frames Peptide Mapping T1 Ribonuclease maps FingerPrint Plasmid Maps PlasmidMap. Restriction Maps. Map MapSort MapPlot. Peptide Maps. PeptideMap PeptideSort. Restriction Enzyme Mapping.

loader
I am the owner, or an agent authorized to act on behalf of the owner, of the copyrighted work described.
capcha
Download Presentation

PowerPoint Slideshow about 'Mapping' - Samuel


An Image/Link below is provided (as is) to download presentation

Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author.While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server.


- - - - - - - - - - - - - - - - - - - - - - - - - - E N D - - - - - - - - - - - - - - - - - - - - - - - - - -
Presentation Transcript
Mapping l.jpg

Mapping

Nucleic Acids and Proteins


Mapping2 l.jpg
Mapping

  • Restriction Mapping

  • Open Reading Frames

  • Peptide Mapping

  • T1 Ribonuclease maps

    • FingerPrint

  • Plasmid Maps

    • PlasmidMap


Restriction maps l.jpg
Restriction Maps

  • Map

  • MapSort

  • MapPlot


Peptide maps l.jpg
Peptide Maps

  • PeptideMap

  • PeptideSort



Restriction enzyme data l.jpg
Restriction Enzyme Data

  • REBASE

    • Dr. Richard J. Roberts CSHL, NEB

    • Release 003 3/2000

    • http://rebase.neb.com

  • enzyme.dat

    • Enzyme

    • Cutting Characteristics

    • Sources

    • References


Restriction enzyme information l.jpg
Restriction Enzyme Information

  • Sources

    • GenMoreData:enz_sources.txt

    • Letter in enzyme.dat refers to source

  • References

    • GenMoreData:enz_refs.txt

    • Use number listed by enzyme in enzyme.dat


Enz sources txt l.jpg
enz_sources.txt

REBASE version 003 commdata.003

=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=

REBASE, The Restriction Enzyme Database http://rebase.neb.com

Copyright (c) Dr. Richard J. Roberts, 2000. All rights reserved.

=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=

Rich Roberts Mar 01 2000

::::::::::::::::::::::::::::::

RESTRICTION ENZYMES

AND

METHYLASES

COMMERCIALLY AVAILABLE

AS OF

Wed, Mar 01, 2000

::::::::::::::::::::::::::::::


Slide9 l.jpg

Advanced Biotechnologies Ltd. (REBASE abbr: T)

Unit 7, Mole Business Park 3, Randalls Rd, Leatherhead, Surrey KT22 7BA

UK

Tel: 01372 360 123

Fax: 01372 363 263

WWW: www.adbio.co.uk

As of: Jan 2 1997 10:16AM

AluI, BamHI, BcoI, BglI, BglII, BscBI, BscCI

BscFI, BshI, BsiBI, BsiCI, BsiLI, BsiMI, BsiQI

BsiXI, BsiYI, BsiZI, ClaI, EcoRI, EcoRV, HaeIII

HindIII, HinfI, HpaI, KpnI, MboI, NciI, NcoI

NotI, NruI, PstI, PvuII, RsaI, SacI, SacII

SalI, SfiI, SmaI, SpeI, SphI, StuI, TaqI

XbaI, XhoI


Slide10 l.jpg

New England BioLabs (REBASE abbr: N)

32 Tozer Rd., Beverly, MA 01915

USA

Tel: 1-800-632-5227

Email: info@neb.com

WWW: www.neb.com

As of: May 20 1997 11:07AM

AatII, Acc65I, AccI, AciI, AclI, AflII, AflIII

AgeI, AhdI, AluI, AlwI, AlwNI, ApaI, ApaLI

ApoI, AscI, AseI, AvaI, AvaII, AvrII, BamHI

BanI, BanII, BbsI, BbvI, BcgI, BciVI, BclI

BfaI, BglI, BglII, BlpI, BpmI, BsaAI, BsaBI

BsaHI, BsaI, BsaJI, BsaWI, BseRI, BsgI, BsiEI

BsiHKAI, BsiWI, BslI, BsmAI, BsmBI, BsmFI, BsmI

BsoBI, Bsp120I, Bsp1286I, BspDI, BspEI, BspHI, BspMI

BsrBI, BsrDI, BsrFI, BsrGI, BsrI, BssHII, BssKI

BssSI, BstAPI, BstBI, BstEII, BstF5I, BstNI, BstUI

BstXI, BstYI, BstZ17I, Bsu36I, Cac8I, ClaI, Csp6I

DdeI, DpnI, DpnII, DraI, DraIII, DrdI, EaeI

EagI, EarI, Ecl136II, Eco47III, Eco57I, EcoNI, EcoO109I

EcoRI, EcoRV, EheI, Fnu4HI, FokI, FseI, FspI

HaeII, HaeIII, HgaI, HhaI, HincII, HindIII, HinfI

HinP1I, HpaI, HpaII, HphI, KasI, KpnI, MboI

MboII, McrBC, MfeI, MluI, MnlI, MscI, MseI

MslI, MspA1I, MspI, MwoI, NaeI, NarI, NciI

NcoI, NdeI, NgoMI, NheI, NlaIII, NlaIV, NotI

NruI, NsiI, PacI, PaeR7I, PflFI, PflMI, PleI

PmeI, PmlI, Ppu10I, PpuMI, PshAI, Psp1406I, PstI

PvuI, PvuII, RsaI, RsrII, SacI, SacII, SalI

SapI, Sau3AI, Sau96I, SbfI, ScaI, ScrFI, SfaNI

SfcI, SfiI, SmaI, SmlI, SnaBI, SpeI, SphI

SspI, StuI, StyI, TaiI, TaqI, TfiI, TseI

Tsp45I, Tsp509I, TspRI, Tth111I, XbaI, XcmI, XhoI

XmaI, XmnI


Slide11 l.jpg

M.AluI, M.BamHI, M.ClaI, M.EcoDam, M.EcoRI, M.FnuDII, M.HaeIII

M.HhaI, M.HpaII, M.MspI, M.PstI, M.SssI, M.TaqI

I-CeuI, I-PpoI, PI-PspI, PI-SceI, PI-TliI

Distributors for New England BioLabs:

MIGLIORE LACLAUSTRA S.R.L.

Av. Cordoba 1470 6o 12, 1055 Buenos Aires

Argentina

Tel: (1) 3729045

Fax: (1) 3729045

GENESEARCH PTY. LTD.

14 Technology Drive, Arundel, Queensland 4214

Australia

Tel: (075) 94-0299

Fax: (075) 94-0562

Email: Genesearch@eworld.com

BIOAGENCY

Av. Anglica, 501-9o andar, So Paulo SP CEP 01227-000

Brazil

Tel: (011) 66-3565,67-3993

Fax: (011) 825-2225


Enz refs txt l.jpg
enz_refs.txt M.HaeIII

REBASE version 003 gcgref.003

=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=

REBASE, The Restriction Enzyme Database http://rebase.neb.com

Copyright (c) Dr. Richard J. Roberts, 2000. All rights reserved.

=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=

Rich Roberts Mar 01 2000

References:

1. Abdurashitov, M.A., Belichenko, O.A., Degtyarev, S.K., Unpublished observ

ations.

2. Abdurashitov, M.A., Belichenko, O.A., Lebedeva, N.A., Dedkov, V.S., Degty

arev, S.K., Unpublished observations.

3. Abdurashitov, M.A., Belichenko, O.A., Lebedeva, N.A., Degtyarev, S.Kh., (

1999) Biokhimiia, vol. 64, pp. 574-576.

4. Abdurashitov, M.A., Belichenko, O.A., Shevchenko, A.V., Dedkov, V.S., Deg

tyarev, S.Kh., (1997) Nucleic Acids Res., vol. 25, pp. 2301-2302.


Enzyme dat l.jpg
enzyme.dat M.HaeIII

  • Heading information

  • .. Divider

  • Enzyme data

    • One site per line

    • Comments follow ! on line


Enzyme fields l.jpg
Enzyme fields M.HaeIII

  • Separated by at least one blank space


Slide15 l.jpg
Name M.HaeIII

  • 1 - 31 characters

  • Names starting with a semicolon ;

    • Only used when specified

    • Not used when you answer * at the prompt

    • Isoschizomer of a more common enzyme


Offset number l.jpg
Offset number M.HaeIII

  • Where to mark the recognition site

    • Top strand cut point


Recognition site l.jpg
Recognition site M.HaeIII

  • 5' - 3'

  • N term - C term

    • Proteases

  • 1 to 60 characters

  • Apostrophe `

    • Cut site top strand

  • Underscore _

    • Cut site bottom strand


Overhang l.jpg
Overhang M.HaeIII

  • Number of symbols from the cut point on the top strand where the bottom strand is cut


Slide19 l.jpg

REBASE version 003 gcgenz.003

=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=

REBASE, The Restriction Enzyme Database http://rebase.neb.com

Copyright (c) Dr. Richard J. Roberts, 2000. All rights reserved.

=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=-=

Rich Roberts Mar 01 2000

REBASE codes for commercial sources of enzymes

A Amersham Pharmacia Biotech (11/98)

B Life Technologies Inc. (1/98)

C Minotech, Molecular Biology Products (3/99)

D Angewandte Gentechnologie Systeme (10/97)

E Stratagene (1/98)

F Fermentas AB (8/99)

G Appligene Oncor (10/97)

H American Allied Biochemical, Inc. (10/98)

I SibEnzyme Ltd. (9/99)

J Nippon Gene Co., Ltd. (10/97)


Slide20 l.jpg

.. gcgenz.003

;AatI 3 AGG'CCT 0

! Eco147I,Pme55I,StuI,SseBI > O 1062

AatII 5 G_ACGT'C -4

! > ADEFKLMNOPRS 1062,1239

;AauI 1 T'GTAC_A 4

! Bsp1407I,BsrGI,SspBI > I 978

AccI 2 GT'mk_AC 2

! > ABDEGJKLMNOPQRS 470,472,611,1260

;AccII 2 CG'CG 0

! BstUI,MvnI,ThaI,Bsh1236I > AJKQ 501,1260

;AccIII 1 T'CCGG_A 4

! BseAI,BsiMI,Bsp13I,BspEI,Kpn2I,MroI > EJKQR 502,739

;Acc16I 3 TGC'GCA 0

! AviII,FspI,NsbI > DI 213

;Acc65I 1 G'GTAC_C 4

! Asp718I,KpnI > DFINR 828

;Acc113I 3 AGT'ACT 0

! Eco255I,ScaI > I 211

;AccB1I 1 G'GyrC_C 4

! BanI,Eco64I,BshNI > I 213

;AccB7I 7 CCAn_nnn'nTGG -3

! PflMI,Van91I,Esp1396I > IR 209

;AccBSI 3 CCG'CTC 0

! BsrBI > DI 737


Translation l.jpg

Translation gcgenz.003

Map(and many other programs)


Translation tables l.jpg
Translation Tables gcgenz.003

  • Heading information precedes .. divider

  • One amino acid per line

  • Each field is separated by one or more spaces


Fields l.jpg
Fields gcgenz.003

  • Single letter symbol

  • Three letter symbol

  • Listing of all unambiguous codons

    • Separate by a space

  • Exclamation point !

    • Listing of ambiguous codons


Start and stop codons l.jpg
Start and Stop Codons gcgenz.003

  • Start codons

    • List as lower case letters

    • All other codons are upper case

  • Stop Codons

    • * - single letter

    • end - three letter


Slide25 l.jpg

Standard Translation Table gcgenz.003

Symbol 3-letter Codons ! IUPAC ..

A Ala GCT GCC GCA GCG ! GCX

B Asx ! RAY

C Cys TGT TGC ! TGY

D Asp GAT GAC ! GAY

E Glu GAA GAG ! GAR

F Phe TTT TTC ! TTY

G Gly GGT GGC GGA GGG ! GGX

H His CAT CAC ! CAY

I Ile ATT ATC ATA ! ATH

J ??? ... ! ...

K Lys AAA AAG ! AAR

L Leu TTG TTA CTT CTC CTA CTG ! TTR CTX YTR ; YTX

M Met atg ! ATG

N Asn AAT AAC ! AAY


Slide26 l.jpg

O ??? ... ! ... gcgenz.003

P Pro CCT CCC CCA CCG ! CCX

Q Gln CAA CAG ! CAR

R Arg CGT CGC CGA CGG AGA AGG ! CGX AGR MGR ; MGX

S Ser TCT TCC TCA TCG AGT AGC ! TCX AGY ; WSX

T Thr ACT ACC ACA ACG ! ACX

U ??? ... ! ...

V Val GTT GTC GTA GTG ! GTX

W Trp TGG ! TGG

X Xxx ! XXX

Y Tyr TAT TAC ! TAY

Z Glx ! SAR

. ... ... ! ...

* End TAA TAG TGA ! TAR TRA ; TRR


Alternate translation tables l.jpg
Alternate Translation Tables gcgenz.003

  • Modified from those used at NCBI

  • Located in GenMoreData

  • transl_table_01.txt


Alternate translation tables28 l.jpg
Alternate Translation Tables gcgenz.003

  • 1 - Standard Code

  • 2 - Vertebrate Mitochondrial

  • 3 - Yeast Mitochrondrial

  • 4 - Mold, Protozoan, and Coelenterate Mitochondrial and the Mycoplasma/Spiroplasma

  • 5 - Invertebrate Mitochondrial

  • 6 - Ciliate, Dasycladacean and Hexamita nuclear

  • 9 - Echinoderm (starfish and sea urchin) Mitochondrial


Alternate translation tables29 l.jpg
Alternate Translation Tables gcgenz.003

  • 10 - Euplotid Nuclear

  • 11 - Bacterial Code

    • Alternative Initiation Codons GUG, UUG, AUU, CUG

  • 12 - Alternative Yeast Nuclear

  • 13 - Ascidian Mitochondrial

  • 14 - Flatworm Mitochondrial

  • 15 - Blepharisma Mitochondrial

  • 16 - Chlorophycean Mitochondrial

  • 21 - Chlorophycean Mitochondrial


Slide30 l.jpg

!!GENETIC_CODE 1.0 gcgenz.003

transl_table = 4

This file contains the Mold, Protozoan, and Coelenterate

Mitochondrial and the Mycoplasma/Spiroplasma Code translation

table, specified in the Feature Definition, Version 1.08, formatted

for use with GCG programs. It names amino acids in both one and

three-letter form and lists the codons which should translate into

them. All GCG translation programs may generate their translations

from the unambiguous codons in this table.

Codons which are all lower case are start codons.

Alternative Initiation Codons:

Trypanosoma: UUA, UUG, CUG

Leishmania: AUU, AUA

Tertrahymena: AUU, AUA, AUG

Paramecium: AUU, AUA, AUG, AUC, GUG, GUA(?)

(Pritchard et al., 1990)


Slide31 l.jpg

Systematic Range: gcgenz.003

Mycoplasmatales: Mycoplasma, Spiroplasma (Bove et al., 1989);

Fungi: Emericella nidulans, Neurospora crassa, Podospora anserina,

Acremonium (Fox, 1987), Candida parapsilosis (Guelin et al., 1991),

Trichophyton rubrum (de Bievre and Dujon, 1992), Dekkera/Brettanomyces,

Eeniella (Hoeben et al.,1993), and probably Ascobolus immersus,

Aspergillus amstelodami, Claviceps purpurea, and Cochliobolus

heterostrophus.

Protozoa: Trypanosoma brucei, Leishmania tarentolae,

Paramecium tetraurelia, Tetrahymena pyriformis and probably

Plasmodium gallinaceum (Aldritt et al., 1989)].

Metazoa: Coelenterata (Ctenophora and Cnidaria)


Slide32 l.jpg

Comments: gcgenz.003

* This code is also used for the kinetoplast DNA (maxicircles,

minicircles). Kinetoplasts are modified mitochondria (or their parts).

* This code is not used in the Acholeplasmataceae and plant-pathogenic

mycoplasma-like organisms (MLO) (Lim and Sears, 1992)

This code differs from the standard code in the following codons:

Mitochondrion Standard

W Trp TGA * End TGA

The Mold, Protozoan, and Coelenterate Mitochondrial

and Mycoplasma/Spiroplasma Code


Slide33 l.jpg

Symbol 3-letter Codons ! IUPAC ..

A Ala GCT GCC GCA GCG ! GCX

B Asx ! RAY

C Cys TGT TGC ! TGY

D Asp GAT GAC ! GAY

E Glu GAA GAG ! GAR

F Phe TTT TTC ! TTY

G Gly GGT GGC GGA GGG ! GGX

H His CAT CAC ! CAY

I Ile att atc ata ! ATH

J ??? ... ! ...

K Lys AAA AAG ! AAR

L Leu tta ttg CTT CTC CTA ctg ! TTR CTX YTR

M Met atg ! ATG

N Asn AAT AAC ! AAY

O ??? ... ! ...

P Pro CCT CCC CCA CCG ! CCX

Q Gln CAA CAG ! CAR

R Arg CGT CGC CGA CGG AGA AGG ! CGX AGR MGR

S Ser TCT TCC TCA TCG AGT AGC ! TCX AGY

T Thr ACT ACC ACA ACG ! ACX

U ??? ... ! ...

V Val GTT GTC GTA gtg ! GTX

W Trp TGG TGA ! TGR

X Xxx ! XXX

Y Tyr TAT TAC ! TAY

Z Glx ! SAR

. ... ... ! ...

* End TAA TAG ! TAR


Slide34 l.jpg
Map ..

  • Sequence listing

  • Restriction Sites listed above the sequence

  • Amino acid translation below the sequence


Slide35 l.jpg

analyze% map -check ge:humcftrm ..

Map maps a DNA sequence and displays both strands of the mapped sequence

with restriction enzyme cut points above the sequence and protein

translations below. Map can also create a peptide map of an amino acid

sequence.

Minimal Syntax: % map [-INfile=]gamma.seq -Default

Prompted Parameters:

-BEGin=2161 -END=2600 range of sequence in which to look for sites

-ENZymes=*[,...] chooses the enzymes used in the search

-MENu=s translation frames s=six, t=three, o=open

[-OUTfile=]gamma.map output file name

Local Data Files:

-DATa=enzyme.dat restriction enzyme names and recognition sites

-DATa=proenzyme.dat peptidases and peptide cleavage reagents

-TRANSlate=translate.txt the genetic code

TRANSlate=15 (number of translation table)


Slide36 l.jpg

Optional Parameters: ..

-WIDth=100 sets display width to something other than 60 bp-line

-PAGe[=62] adds form-feeds to keep clusters on a single page

-OPEn[=20] translates only in open reading frames [minimum ORF length]

-ONCe shows only enzymes that cut once

-MINCuts=2 shows only enzymes that cut at least 2 times

-MAXCuts=2 shows only enzymes that cut no more than 2 times

-EXCLude=n1,n2 doesn't show enzymes that cut between bases n1 and n2

-ALL finds "overlapping-set" matches

-PERFect finds only perfect symbol matches between site and sequence

-CIRcular treats the sequence as circular

-LINear treats the sequence as linear (default)

-APPend appends enzyme data file to your output

-THReeletter uses three-letter amino acid codes to show translation

-SILent finds translationally silent potential restriction sites


Slide37 l.jpg

-MISmatch=1 finds restriction sites with one or fewer mismatches

-NOSEQline suppresses the sequence display

-NOSCALeline suppresses the scale line

-NOCOMPline suppresses the complement sequence display

-NOCUTline suppresses line of '|' characters showing cut points

-MINSitelen=6 selects enzymes with 6 (or more) bases in

recognition site

-OVErhang=0 selects only blunt-end cutters ("5" for 5', "3" for 3')

-VERtical displays enzyme names vertically over cut points

-BOTtom shows both forward and reverse strand cut points

-CUTters[=fn] writes enzyme data file with enzymes that did cut

-NONCUTters[=fn] writes enzyme data file with enzymes that did not cut

-EXCUTters[=fn] writes enzyme data file with enzymes that were excluded

-TABle shows the map as a list of cut positions,

sorted by position

-SORtbyenzyme sorts table output first by enzyme,

then by cut position

-NOMONitor suppresses the screen monitor

-NOSUMmary suppresses the screen summary

Add what to the command line ? -once


Slide38 l.jpg

Begin (* 1 *) ? mismatches

End (* 6129 *) ?

Select the enzymes: Type nothing or "*" to get all enzymes. Type "?"

for help on which enzymes are available and how to select them.

Enzyme(* * *): ?

Select enzymes:

Type "*" to select all enzymes.

Type "**" to select all enzymes including isoschizomers.

Type individual names like "AluI" to select specific enzymes.

Type "?" to see this message and all available enzymes.

Type "??" to see the available enzymes AND their recognition sites.

Type "?A*" to see what enzymes start with "A."

Type "A*" to select all enzymes starting with "A."

Type parts of names like "Al*" to select all enzymes starting with "AL."

Type "~A*" to unselect all selected enzymes starting with "A."

Type "/*" to see what enzymes you have selected so far.

Type " " to select no enzymes at all.

Press <Return> after each selection.

Press <Return> and nothing else to end your selections.

Spaces are allowed; upper and lower case are equivalent.


Slide39 l.jpg

AatI AatII AauI AccI AccII AccIII Acc16I

Acc65I Acc113I AccB1I AccB7I AccBSI AceIII AciI

AclI AclNI AclWI AcsI AcyI AfaI AfeI

AflII AflIII AgeI AhaIII AhdI AluI AlwI

Alw21I Alw26I Alw44I AlwNI Ama87I AocI Aor51HI

ApaI ApaBI ApaLI ApoI AscI AseI AsiAI

AsnI AspI Asp700I Asp718I AspEI AspHI AspLEI

AspS9I AsuI AsuII AsuC2I AsuHPI AsuNHI AvaI

AvaII AvaIII AviII AvrII AxyI BaeI BaeI

BalI BamHI BanI BanII BanIII BbeI BbiII

BbrPI BbsI BbuI BbvI BbvII Bbv12I BccI

Bce83I BcefI BcgI BcgI BciVI BclI BcnI

BcoI BetI BfaI BfiI BfmI BfrI BglI

BglII BinI BlnI BlpI Bme18I BmgI BmyI

BpiI BplI BpmI Bpu10I Bpu14I Bpu1102I BpuAI

BsaI Bsa29I BsaAI BsaBI BsaHI BsaJI BsaMI

BsaOI BsaWI BsaXI BsbI BscI Bsc4I BscBI

BscCI BscFI BscGI Bse1I Bse8I Bse21I Bse118I

Bse3DI BseAI BseCI BseDI BseGI BseLI BseMII


Slide40 l.jpg

What protein translations do you want: Acc16I

a) frame 1 b) frame 2 c) frame 3

d) frame 4 e) frame 5 f) frame 6

t)hree forward frames s)ix frames o)pen frames only

n)o protein translation q)uit

Please select (capitalize for 3-letter) (* t *):

What should I call the output file (* humcftrm.map *) ?

Mapping .........................

Writing .......... ..

MAP complete with:

Sequence Length: 6,129

Enzymes Chosen: 217

Cutsites found: 1,162

CPU time: 04.17

Output file(s): humcftrm.map


Slide41 l.jpg

(Linear) MAP of: gb_pr1:humcftrm check: 6781 from: 1 to: 6129

LOCUS HUMCFTRM 6129 bp mRNA PRI 15-DEC-1989

DEFINITION Human cystic fibrosis mRNA, encoding a presumed transmembrane

conductance regulator (CFTR).

ACCESSION M28668

NID g180331

KEYWORDS cystic fibrosis; transmembrane conductance regulator. . . .

With 217 enzymes: *

MaxCuts: 1

April 22, 1998 18:07 ..


Slide42 l.jpg

BsrBI 6129

|

AATTGGAAGCAAATGACATCACAGCAGGTCAGAGAAAAAGGGTTGAGCGGCAGGCACCCA

1 ---------+---------+---------+---------+---------+---------+ 60

TTAACCTTCGTTTACTGTAGTGTCGTCCAGTCTCTTTTTCCCAACTCGCCGTCCGTGGGT

a N W K Q M T S Q Q V R E K G L S G R H P -

b I G S K * H H S R S E K K G * A A G T Q -

c L E A N D I T A G Q R K R V E R Q A P R -

1 ---------+---------+---------+---------+---------+---------+ 60

d I P L L H C * L L D S F F P Q A A P V W -

e Q F C I V D C C T L S F P N L P L C G -

f N S A F S M V A P * L F L T S R C A G -

EcoO109I

Psp5II

SanDI

|

GAGTAGTAGGTCTTTGGCATTAGGAGCTTGAGCCCAGACGGCCCTAGCAGGGACCCCAGC

61 ---------+---------+---------+---------+---------+---------+ 120

CTCATCATCCAGAAACCGTAATCCTCGAACTCGGGTCTGCCGGGATCGTCCCTGGGGTCG

a E * * V F G I R S L S P D G P S R D P S -

b S S R S L A L G A * A Q T A L A G T P A -

c V V G L W H * E L E P R R P * Q G P Q R -

61 ---------+---------+---------+---------+---------+---------+ 120

d L L L D K A N P A Q A W V A R A P V G A -

e S Y Y T K P M L L K L G S P G L L S G L -

f L T T P R Q C * S S S G L R G * C P G W -


Slide43 l.jpg

Enzymes that do cut and were not excluded: 6129

AvaI AvrII BaeI BcgI BmgI Bpu10I BsaHI BsaXI

BspEI BsrBI BsrGI BstXI BstZ17I ClaI EcoO109I FspI

HpaI KpnI NciI NruI PmlI Psp5II SanDI SpeI

SphI ThaI Tth111I UbaEI XbaI

Enzymes that do not cut:

AatII AhdI ApaI ApaLI AscI BsaBI BscGI BsiEI

BsmBI BspLU11I BsrFI BssHII BstAPI BstEII DrdI EagI

EciI Eco47III EcoRV FauI FseI GdiII HgiEII MluI

MunI NarI NdeI NgoAIV NheI NotI NsiI NspV

PacI Pfl1108I PinAI PmeI PshAI Psp1406I PstI PvuI

RsrII SacII SalI SapI SbfI SexAI SfiI SgfI

SgrAI SmaI SmiI SnaBI SrfI Sse8647I StuI SunI

TaqII UbaDI XhoI

Enzymes excluded; MinCuts: 1 MaxCuts: 1

AccI AceIII AciI AflII AflIII AluI AlwI AlwNI

ApoI AvaII BaeI BamHI BanI BanII BbsI BbvI

BccI Bce83I BcefI BcgI BciVI BclI BfaI BfiI

BglI BglII BplI BpmI Bpu1102I BsaI BsaAI BsaJI

BsaWI BsbI BseMII BseRI BsgI BsiHKAI BslI BsmI

BsmAI BsmFI Bsp24I Bsp24I Bsp1286I BspGI BspMI BsrI

BsrDI BssSI Bst4CI BstDSI BstYI Bsu36I Cac8I CjeI

CjeI CjePI CjePI CviJI CviRI DdeI DpnI DraI

DraIII DrdII EaeI EarI Eco57I EcoNI EcoRI EcoRII

Fnu4HI FokI HaeI HaeII HaeIII HgaI HhaI Hin4I

HincII HindIII HinfI HphI MaeIII MboII MmeI MnlI

MscI MseI MslI MspI MspA1I MwoI NcoI NlaIII

NlaIV NspI PflMI PleI PvuII RcaI RleAI RsaI

SacI Sau96I Sau3AI ScaI ScrFI SfaNI SfcI SimI

SmlI SspI StyI TaiI TaqI TaqII TatI TauI

TfiI TseI Tsp45I Tsp509I TspRI Tth111II VspI XcmI

XmnI


Mapsort l.jpg
MapSort 6129

  • Enzymes listed alphabetically

    • Display cut positions for each enzyme

    • Fragments arranged by size

  • Shows products of multiple digests


Slide45 l.jpg

analyze% mapsort -check ge:humcftrm 6129

MapSort finds the coordinates of the restriction enzyme cuts in a

DNA sequence and sorts the fragments of the resulting digest by size.

MapSort can sort the fragments from single or multiple enzyme

digests.

Minimal Syntax: % mapsort [-INfile=]GenBank:SynpBR322 -Default

Prompted Parameters:

-BEGin=1 -END=4361 range of interest

-CIRcular treats chosen range as circular

-ENZymes=*,[.,.,.] enzymes to be mapped

-OUTfile=synpbr322.mapsort output file name

Local Data Files:

-DATa=enzyme.dat restriction enzyme names and recognition sites

-DATa=proenzyme.dat peptidases and peptide cleavage reagents

-TRANSlate=translate.txt contains the genetic code


Slide46 l.jpg

Optional Parameters: 6129

-ONCe shows enzymes that cut only once

-MINCuts=2 shows only enzymes that cut at least 2 times

-MAXCuts=2 shows only enzymes that cut no more than 2 times

-EXCLude=n1,n2 suppresses enzymes that cut between bases n1 and n2

-DIGest sort the cuts for all the enzymes together in one

digest

-LINear treats chosen range as linear (default)

-ALL does an "overlapping-set" map

-PERFect looks only for perfect matches

-NOSIZe suppresses the report of fragment sizes in your output

-MISmatch=1 finds potential sites with one or fewer mismatches.

-SILent finds translationally silent potential restriction sites

-PLAsmid makes output suitable for display by PLASMIDMAP

-FRAGments puts "blocks" not "ticks" into the PLASMIDMAP label file

-APPend appends enzyme file and translation table to your output

-CUTters[=fn] writes enzyme data file with enzymes that did cut

-NONCUTters[=fn] writes enzyme data file with enzymes that did not cut

-EXCUTters[=fn] writes enzyme data file with enzymes that were excluded

-MINSitelen=6 selects enzymes with 6 (or more) bases in

recognition site

-OVErhang=0 selects only blunt-end cutters ("5" for 5', "3" for 3')

Add what to the command line ? -once


Slide47 l.jpg

Begin (* 1 *) ? 6129

End (* 6129 *) ?

Is this sequence circular (* No *) ?

Select the enzymes: Type nothing or "*" to get all enzymes. Type "?"

for help on which enzymes are available and how to select them.

Enzyme(* * *):

What should I call the output file (* humcftrm.mapsort *) ?

Mapping ......

analyze%


Slide48 l.jpg

(Linear) MAPSORT of: gb_pr1:humcftrm Check: 6781 from: 1 to: 6129

With 217 enzymes: *

MaxCuts: 1

April 22, 1998 18:09 ..

AvaI C'yCGr_G

Cuts at: 0 122 6129

Size: 122 6007

AvrII C'CTAG_G

Cuts at: 0 5863 6129

Size: 5863 266

BaeI ACnnnnGTAyCnnnnnnn_nnnnn'

Cuts at: 0 1433 6129

Size: 1433 4696


Slide49 l.jpg

(Linear) to: 6129(Silent) MAPSORT of: gb_pr1:humcftrm

With 217 enzymes: *

MaxCuts: 1

April 22, 1998 18:11 ..

AscI GG'CGCG_CC

Cuts at: 0 2419* 6129

Size: 2419 3710

FseI GG_CCGG'CC

Cuts at: 0 848* 6129

Size: 848 5281

PmeI GTTT'AAAC

Cuts at: 0 2193* 6129

Size: 2193 3936

Note: The range you define must specify a coding region and reading frame precisely


Slide50 l.jpg

(Linear) MAPSORT of: synpgem3v.gb_sy to: 6129

With 2 enzymes: ECORI AATII

April 22, 1998 18:14 ..

AatII G_ACGT'C

Cuts at: 0 2095 2867

Size: 2095 772

EcoRI G'AATT_C

Cuts at: 0 58 2867

Size: 58 2809


Slide51 l.jpg

(Linear) to: 6129(Digest) MAPSORT of: synpgem3v.gb_sy

With 2 enzymes: ECORI AATII

April 22, 1998 18:15 ..

A: AatII G_ACGT'C B: EcoRI G'AATT_C

Cuts at: 0 58B 2095A 2867

Size: 58 2037 772

Fragments arranged by size:

2037 772 58


Mapplot l.jpg
MapPlot to: 6129

  • Graphical representation of the sequence

  • Tick marks at Cut Sites

    • Overhang display

  • Boxed features


Slide53 l.jpg

analyze% mapplot -check synpgem3v.gb_sy to: 6129

MapPlot displays restriction sites graphically. If you don't have a

plotter, MapPlot can write a text file that approximates the graph.

Minimal Syntax: % mapplot [-INfile=]GenBank:SynpBR322 -Default

Prompted Parameters:

-BEGin=1 -END=4361 the range of interest

-ENZymes=*[,...] the enzymes to display

Local Data Files:

-DATa=enzyme.dat restriction enzyme names and recognition sites

-DATa=proenzyme.dat peptidases and peptide cleavage reagents

-TRANSlate=translate.txt the genetic code

-MARk=synpbr322.mrk marks regions of interest below the plot


Slide54 l.jpg

Optional Parameters: to: 6129

-CIRcular treats the sequence as circular (default is linear)

-ONCe displays only enzymes that cut once

-MINCuts=2 displays only enzymes that cut at least 2 times

-MAXCuts=2 displays only enzymes that cut no more than 2 times

-EXCLude=n1,n2 suppresses enzymes cutting between bases n1 and n2

-MISmatch=1 finds potential sites with one or fewer mismatches

-SILent finds translationally silent potential restriction

sites

-ALL finds "overlapping-set" matches

-PERFect looks only for perfect matches

-DENsity=4361 sets the number of bases per 100 platen units

-SPAcing=1.6 sets the number of platen units per line

[-OUTfile=]pbr322.mapplot makes a text file representation of the plot

-WIDth=45 number of columns (30-100) in text output

-NOPLOt suppresses the plot

-APPend appends the enzyme file to the text output

-MINSitelen=6 selects enzymes with 6 (or more) bases in recognition

site

-OVErhang=0 selects only blunt-end cutters ("5" for 5', "3" for 3')

-CUTters[=fn] writes enzyme data file with enzymes that did cut

-NONCUTters[=fn] writes enzyme data file with enzymes that did not cut

-EXCUTters[=fn] writes enzyme data file with enzymes that were excluded


Slide55 l.jpg

All GCG graphics programs accept these and other switches. See the Using

Graphics chapter of the USERS GUIDE for descriptions.

-FIGure[=FileName] stores plot in a file for later input to FIGURE

-FONT=3 draws all text on the plot using font 3

-COLor=1 draws entire plot with pen in stall 1

-SCAle=1.2 enlarges the plot by 20 percent (zoom in)

Press q to quit or <Return> for more:

-XPAN=10.0 moves plot to the right 10 platen units (pan right)

-YPAN=10.0 moves plot up 10 platen units (pan up)

-PORtrait rotates plot 90 degrees

Add what to the command line ?


Slide56 l.jpg

Process set to plot with COLORSCRIPT-100 attached to mapplot.ps

using the psd graphic interface.

Begin (* 1 *) ?

End (* 2867 *) ?

Select the enzymes: Type nothing or "*" to get all enzymes. Type "?"

for help on which enzymes are available and how to select them.

Enzyme(* * *):

PostScript instructions for a COLORSCRIPT-100 are now being sent

to mapplot.ps.


Gamma mrk l.jpg
gamma.mrk mapplot.ps

!!MARK 1.0

Plots the marking regions for the sequence Gamma.Seq

A set of regions is identified in a sequence.

Each region is identified by a rectangle next to the axis in

plot programs that support "marking regions of interest."

Lines that start with a '!' are ignored.

All the "words" in the file below the line with the '..' that can be interpreted as integers are added to the regions of interest array so a bad number may cause a frame shift in the "from->to" sense.


Slide58 l.jpg

The regions below identify the coding regions of the mapplot.ps

fetal beta globins G and A gamma.

From To ..

! Alu sequence 5' to g gamma

137 348

! human fetal beta globin g gamma coding regions

2179 2270

2393 2615

3502 3630

! human fetal beta globin a gamma coding regions

7114 7205

7338 7550 these words won't be read because they are not integers

8417 8545


Slide59 l.jpg

LOCUS SYNPGEM3V 2867 bp DNA circular SYN 04-JUN-1993

DEFINITION pGEM3 cloning vector Gemini 3 from Promega Biotec.

ACCESSION L08872

NID g310773

KEYWORDS .

SOURCE Synthetic construct DNA.

ORGANISM synthetic construct

artificial sequence.

REFERENCE 1 (bases 1 to 2867)

AUTHORS Gilbert,W.

TITLE Obtained from VecBase 3.0

JOURNAL Unpublished (1991)

COMMENT These data and their annotation were supplied to GenBank by Will

Gilbert under the auspices of the GenBank Currator Program. pGEM3 -

Cloning Vector Gemini 3 from Promega Biotec ENTRY PGEM3

#TYPE DNA CIRCULAR

TITLE pGEM3 - Cloning Vector Gemini 3 from Promega Biotec DATE

27-MAR-1986

#sequence 11-DEC-1986

#sequence 16-DEC-1986 ACCESSION VB0038

SOURCE artificial

REFERENCE

#number 1

#citation Promega technical Bulletin

#comment The sequence was revised by Promega Biotec JUL-1986

Promega also confirmed the revision of DEC-1986

#comment copyright of the sequence by Promega


Slide60 l.jpg

PARENT 04-JUN-1993

Features of pGEM3 (2867 bp)

residue source

7- 63 57- 1 (c) M13mp18/pUC18-polylinker

70- 89 20- 1 (c) T7 promoter

100-2160 626-2686 pUC18c

2161-2347 1- 187 pUC18c

2348-2433 654- 569 (c) pBR322

2434-2622 564- 376 (c) pBR322

2623-2867 xxxx-xxxx phage SP6

2849-2867 1- 19 SP6 promoter

Conflict (cfl) and Mutations (mut): none

FEATURE

1 start of SP6-RNA synthesis

72 (c) start of T7-RNA synthesis

1103-1891 789-1 (c) Ap-R; b-lactamase

POLYLINKER EcoRI-SacI-KpnI-SmaI-BamHI-XbaI-SalI-

PstI-SphI-HindIII

SELECTION #resistance Ap


Pgem mrk l.jpg
pgem.mrk 04-JUN-1993

..

7 63

! 57- 1 (c) M13mp18/pUC18-polylinker

70 89

! 20- 1 (c) T7 promoter

100 158

! 59- 1 (c) pUC18

159 2347

! 2686- 498 (c) pUC18

2348 2433

! 654- 569 (c) pBR322

2434 2622

! 564- 376 (c) pBR322

2849 2867

! 1- 19 SP6 promoter



Tfd data bases l.jpg
TFD Data Bases 04-JUN-1993

  • GenMoreData:tfsites.dat

  • analyze%fetch tfsites.dat

  • Transcription factor data base

    • Recognition sequences for eukaryotic transcription factors

  • > 5,000 entries


Tfsites dat file l.jpg
tfsites.dat File 04-JUN-1993

  • Site name

  • Sequence

  • Transcription Factor

  • Reference


Slide67 l.jpg

This file is a composite from the following datasets: 04-JUN-1993

TFD (release 7.5) SITES dataset file, 3/96

Transfac (release 2.5) SITES dataset selected entries, 1/96

References: Nucleic Acids Res 21, 3117-8 (1993).

In Gene Transcription: A Practical Approach,

321-45 (1993)

Nucleic Acids Res 24, 238-41 (1996)


Slide68 l.jpg

Name Sequence

UAS(G)-pMH100 0 CGGAGTACTGTCCTCCG 0

! GAL4 J Mol Biol 209: 423-32 (1989)

TFIIIC-Xls-5S.1 0 TGGATGGGAG 0

! TFIIIC EMBO J 6: 3057-63 (1987)

HSE_CS_inverted_repeat 0 CTNGAANNTTCNAG 0

! HSTF Cell 30: 517-28 (1982)

ZDNA_CS 0 GCGTGTGCA 0

! unknown Nature 303: 674-9 (1983)

GCN4-his3-189 0 ATGACTCAT 0

! GCN4 Science 234: 451-7 (1986)

Ad5_EIA_element_I 0 AGGAAGTGAAA 0

! unknown Cell 45: 229-36 (1986)

Ad5_EIA_element_II 0 GGGCGTAACCGAGTAAGATTTGGCCATTTTC 0

! unknown Cell 45: 229-36 (1986)

BPV-E2_CS1 0 ACCGNNNNCGGT 0

! (BPV-E2) Nature 325: 70-3 (1987)

Alb_DEI 0 GATTTTGTAATGG 0

! C/EBP Cell 51: 963-73 (1987)

Alb_DEII 0 TTTTTGGCAAAGAT 0

! CTF/NF-1 Cell 51: 963-73 (1987)

Alb_DEIII 0 GCAAGGGATTTAGTT 0

! unknown Mol Cell Biol 9: 4750-8 (1989)

Alb_PEI 0 TGGTTAATGATCTACAGT 0

! APF/HNF1 Genes Dev 2: 957-74 (1988)

BPV-E2_CS2 0 ACCNNNNNNGGT 0

! BPV-E2 Nucleic Acids Res 15: 10267-84 (1987)

CACA 0 CACACACACA 0

! unknown J Biol Chem 265: 2238- (1990)


Using tfsites dat l.jpg
Using tfsites.dat

  • Any restriction mapping program or FindPatterns can utilize this data file

  • -data=genmoredata:tfsites.dat


Slide70 l.jpg

analyze% mapsort -data=genmoredata:tfsites.dat GB_PR1:HUMHBB

(Linear) MAPSORT of: GB_PR1:HUMHBB

NF-E1.5 TATCTT

Cuts at: 33999 34149 35000

Size: 150 851

NF-E1.6 TATCTC

Cuts at: 33999 34288 35000

Size: 289 712

MAT-OCTA1 ATGCAAAT

Cuts at: 33999 34295 35000

Size: 296 705

MAT-OCTA2 ATTTGCAT

Cuts at: 33999 34303 35000

Size: 304 697


Finding the tfsites reference l.jpg
Finding the TFSites Reference

  • Copy the site name in the results file

  • analyze% to genmoredata

  • grep site_name tfsites.dat | more

  • With a hit to NF-E1.5

    • analyze% grep NF-E1.5 tfsites.dat | more


Slide72 l.jpg

analyze% to genmoredata

/usr1/gcg/gcgcore/data/moredata

analyze% grep NF-E1.5 tfsites.dat | more

NF-E1.5 0 TATCTT 0

! GATA-1 Genes Dev 2: 1089-100 (1988)


Peptide analysis l.jpg
Peptide Analysis

  • Protease cleavage site

  • Isoelectric points

  • Extinction coefficient

  • Charge

  • Molecular weight

  • Hydrophobicity


Peptidemap l.jpg

PeptideMap

Peptide Cleavage Sites


Proenzyme dat l.jpg
proenzyme.dat

!!PATTERNS 1.0

Name Offset Site OverHang Documentation ..

Chymo 1 (F,W,Y,M,L)'~P . ! Chymotrypsin

CnBr 1 M' . ! Cyanogen Bromide

NH2OH 1 N'G . ! Hydroxylamine

NTCB 0 'C . ! NTCB + Ni

pH2.5 1 D'P . ! pH 2.5

ProEn 1 P' . ! Proline Endopeptidase

Staph 1 E' . ! Staphylococcal Protease

Trypsin 1 (K,R)'~P . ! Trypsin


Proenzall dat l.jpg
proenzall.dat

Name Offset Specificity Overhang Documentation ..

!Armillaria 0 '(C,K) . !

ArmillariaMellea 0 'K . !

AspN 0 'D . ! Endoproteinase Asp-N

Chymo 1 (F,W,Y,M,L)'~P . ! Chymotrypsin

Clos 1 R' . ! Clostripain

CnBr 1 M' . ! Cyanogen Bromide

IBzO 1 W' . ! IodosoBenzoate

LysC 1 K' . ! Endoproteinase Lys-C

Myxo 1 K' . ! Myxobacter Armillaria Protease

NH2OH 1 N'G . ! Hydroxylamine

NTCB 0 'C . ! NTCB + Ni

pH2.5 1 D'P . ! pH 2.5

PancreaticElastase 1 (A,G,S,V)' . !

ProEn 1 P' . ! Proline Endopeptidase

Staph 1 E' . ! Staphylococcal Protease

Thermolysin 0 (L,I,M,F,W,V) . !

Trypsin 1 (K,R)'~P . ! Trypsin

TrypK 1 K'~P . ! Trypsin(Arg blocked)

TrypR 1 R'~P . ! Trypsin(Lys blocked)

TrypsinCys 1 (K,R,C)~P . ! Trypsin (cys modified)

V8AmoniumAcetate 1 E'~P . ! Staphylococcus Aureus V8

NoCut 1 @' . ! for calculations on whole peptide


Slide77 l.jpg

(Linear) (Peptide) MAP of: vglg_vsvsj.swissprot check: 9374 from: 1 to: 511

With 8 enzymes: *

April 22, 1998 17:59 ..

Chymo

Trypsin|

Chymo ||

Chymo| ||

Chymo|| || ProEn

Chymo ||| || Chymo |

Chymo| ||| || NTCB |

Chymo|| ||| || Chymo | |

Chymo||| ||| || ProEn | | |

NTCB |||| ||| || Trypsin | | | |

Trypsin |||| ||| || Chymo| | | | | Chymo

Chymo| |||| ||| || Trypsin || | | | | Chymo |

CnBr| |||| |||NTCB ||ProEn | || | | | |Chymo | | Trypsin

|| |||| ||| | || | | || | | | | | | | |

MKCLLYLAFLFIGVNCKFTIVFPHNQKGNWKNVPSNYHYCPSSSDLNWHNDLIGTAIQVK

1 ---------+---------+---------+---------+---------+---------+ 60


Peptidesort l.jpg

PeptideSort 9374 from: 1 to: 511


Slide79 l.jpg

analyze% peptidesort -check vglg_vsvsj.swissprot 9374 from: 1 to: 511

PeptideSort shows the peptide fragments from a digest of an amino acid

sequence. It sorts the peptides by weight, position, and HPLC retention

at pH 2.1, and shows the composition of each peptide. It also prints

a summary of the composition of the whole protein.

Minimal Syntax: % peptidesort [-INfile=]gzeinaa.pep -Default

Prompted Parameters:

-BEGin=18 -END=243 range of interest

-ENZymes=*[,...] enzymes of interest

[-OUTfile=]gzeinaa.pepsort output file name

Local Data Files:

-DATa1=proenzall.dat contains enzyme data

-DATa2=aminoacid.dat contains amino acid data

-DATa3=isoelectric.dat contains amino acid pK data

-DATa4=extinctcoef.dat contains extinction coefficient data


Slide80 l.jpg

Optional parameters: 9374 from: 1 to: 511

-7 sorts on HPLC retention at pH 7.4 instead of pH 2.1

-MINCuts=2 shows only enzymes that cut at least 2 times

-MAXCuts=4 shows only enzymes that cut less than 4 times

-ELUtion[=DNEQSGHRTAPYVMCILFKW]

sets the order of the composition display

Add what to the command line ?

Begin (* 1 *) ?

End (* 511 *) ?

Select the enzymes: Type nothing or "*" to get all enzymes. Type "?"

for help on which enzymes are available and how to select them.

Enzyme(* * *):

What should I call the output file (* vglg_vsvsj.pepsort *) ?


Aminoacid dat l.jpg
aminoacid.dat 9374 from: 1 to: 511

Table used by PEPTIDESORT to find the properties of the different

amino acid residues.

Hydrophobicities assigned according to Janin, Nature 277; 491-492 (1979)

HPLC retention values assigned according to Meek, PNAS 77; 1632-1636

(1980), using a linear acetonitrile gradient, 0.75% per minute, at

room temperature.

AmAcid MolWt Charge Aroma Acid Base Sulfur Phil phob retn2.1 retn7.4

..

Ala 89.09 0 0 0 0 0 0 1 -0.1 0.5

Arg 174.20 1 0 0 1 0 1 0 -4.5 0.8

Asn 132.12 0 0 0 0 0 1 0 -1.6 -0.8

Asp 133.10 -1 0 1 0 0 1 0 -2.8 -8.2

Asx 132.61 -.5 0 1 0 0 1 0 -2.2 -4.5

Ave 128.16 0 0 0 0 0 0 0 0.0 0.0

COO 0 0 0 0 0 0 0 0 6.9 -3.0

Cys 121.15 0 0 0 0 1 0 1 -2.2 -6.8

End 0 0 0 0 0 0 0 0 0.0 0.0


Slide82 l.jpg

PEPTIDESORT of: vglg_vsvsj.swissprot 9374 from: 1 to: 511

Digest with: CnBr. Peptides Sorted by Position

Digest with: CnBr. Peptides Sorted by Weight

Digest with: CnBr. Peptides Sorted by Retention

Digest with: Trypsin. Peptides Sorted by Position

Pos From To Mol Wt Ret2.1 Ret7.4 Chg Aro Acid Base Sulf Phil Phob

1 1 - 2 277.4 10.4 4.3 1.0 0 0 1 1 1 1

K1,M1 Iso=9.67 Ext=0

2 3 - 17 1717.1 87.8 69.9 1.0 3 0 1 2 2 13

A1,C2,F2,G1,I1,K1,L4,N1,V1,Y1 Iso=8.08 Ext=1520

3 18 - 27 1230.4 52.4 42.2 1.0 2 0 1 0 6 4

F2,H1,I1,K1,N1,P1,Q1,T1,V1 Iso=9.68 Ext=0

4 28 - 31 503.6 19.3 13.6 1.0 1 0 1 0 2 2

G1,K1,N1,W1 Iso=9.67 Ext=5690

5 32 - 60 3273.6 75.0 59.4 -1.0 3 2 1 1 17 12

A1,C1,D2,G1,H2,I2,K1,L2,N4,P2,Q1,S4,T1,V2,W1,Y2 Iso=6.49 Ext=8370

6 61 - 63 374.5 18.4 10.4 1.0 0 0 1 1 2 1

K1,M1,P1 Iso=9.67 Ext=0

7 64 - 66 370.4 0.4 -2.8 1.0 0 0 1 0 3 0

H1,K1,S1 Iso=9.68 Ext=0

8 67 - 79 1417.6 29.1 12.5 0.0 1 1 1 2 5 8

A3,C1,D1,G1,H1,I1,K1,M1,Q1,S1,W1 Iso=7.29 Ext=5810


Slide83 l.jpg

Next: 9374 from: 1 to: 511

Pattern Recognition


ad