1 / 1

GA-repeat (aa88-323)

msdegpgtgpgnglgekgdtsgpegsggsgpqrrggdnhgrgrgrgrgrgggrpgapggs gsgprhrdgvrrpqkrpscigckgthggt gagagaggagaggagagggagagggaggagg aggagagggagagggaggaggagagggagagggaggagagggaggaggagagggagaggg aggagagggaggaggagagggagaggaggaggagaggagagggaggaggagaggagagga

yahto
Download Presentation

GA-repeat (aa88-323)

An Image/Link below is provided (as is) to download presentation Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author. Content is provided to you AS IS for your information and personal use only. Download presentation by click this link. While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server. During download, if you can't get a presentation, the file might be deleted by the publisher.

E N D

Presentation Transcript


  1. msdegpgtgpgnglgekgdtsgpegsggsgpqrrggdnhgrgrgrgrgrgggrpgapggs gsgprhrdgvrrpqkrpscigckgthggtgagagaggagaggagagggagagggaggagg aggagagggagagggaggaggagagggagagggaggagagggaggaggagagggagaggg aggagagggaggaggagagggagaggaggaggagaggagagggaggaggagaggagagga gaggagaggaggagaggaggagaggaggagagggaggagaggaggagaggaggagagga ggagaggaggagagggagaggagaggggrgrggsggrgrggsggrgrggsggrrgrgrer arggsrerargrgrgrgekrprspssqssssgspprrpppgrrpffhpvgeadyfeyhqe ggpdgepdvppgaieqgpaddpgegpstgprgqgdggrrkkggwfgkhrgqggsnpkfen iaeglrallarshverttdegtwvagvfvyggsktslynlrrgtalaipqcrltplsrlp fgmapgpgpqpgplresivcyfmvflqthifaevlkdaikdlvmtkpaptcnirvtvcsf ddgvdlppwfppmvegaaaegddgddgdeggdgdegeegqe C-terminal (aa324-641) N-terminal (aa1-87) GA-repeat (aa88-323) E-figure 1. The three main domains of EBNA1 (N-terminal, GA-repeat and C-terminal) are outlined in the primary protein sequence. One epitope (aa 393-407: PPRRPPPGRRPFFHP) located within in the C-terminal domain that was preferentially recognized by MS patients’ sera is underlined in the EBNA1 primary protein sequence. However, additional specificities of EBNA1-targeting IgG in children with MS recognized epitopes throughout the protein and were not restricted to a unique region or domain of EBNA1.

More Related