dasar dasar jurnalisme n.
Download
Skip this Video
Loading SlideShow in 5 Seconds..
Dasar-Dasar Jurnalisme PowerPoint Presentation
Download Presentation
Dasar-Dasar Jurnalisme

Loading in 2 Seconds...

play fullscreen
1 / 49

Dasar-Dasar Jurnalisme - PowerPoint PPT Presentation


  • 120 Views
  • Uploaded on

Yohanes Widodo , S.Sos , M.Sc Prodi Ilmu Komunikasi FISIP UAJY. Dasar-Dasar Jurnalisme. Perkenalan Saya. Yohanes Widodo, S.Sos , M.Sc Nickname: Masboi Email: masboi@yahoo.com , ywidodo@staff.uajy.ac.id Blog: www.masboi.com FB: facebook.com/ masboi

loader
I am the owner, or an agent authorized to act on behalf of the owner, of the copyrighted work described.
capcha
Download Presentation

PowerPoint Slideshow about 'Dasar-Dasar Jurnalisme' - vanna-rodgers


An Image/Link below is provided (as is) to download presentation

Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author.While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server.


- - - - - - - - - - - - - - - - - - - - - - - - - - E N D - - - - - - - - - - - - - - - - - - - - - - - - - -
Presentation Transcript
perkenalan saya
PerkenalanSaya
  • Yohanes Widodo, S.Sos, M.Sc
  • Nickname: Masboi
  • Email: masboi@yahoo.com,
  • ywidodo@staff.uajy.ac.id
  • Blog: www.masboi.com
  • FB: facebook.com/masboi
  • Ayah seorangputeribernamaAnjelie
  • S1: IlmuKomunikasi UAJY 1993-1999
  • S2: Applied Communication Science, Wageningen University, NL 07-09
  • Pendiri SKM PASTI, Redaksi TEROPONG, Ketua SEMA FISIP
  • Bekerjadi Radio Sonora Palembang 1999-2007
  • Pendiri Radio Internet www.radioppidunia.com
  • DosenJurnalisme, ProdiIlmuKomunikasi FISIP UAJY, mulai 4 Januari 2010
ilmu komunikasi dan jurnalistik
IlmuKomunikasidanJurnalistik
  • DalamIlmuKomunikasi, jurnalistikmasukdalam domain kajiankomunikasimassa. Komunikasimassamempunyaibeberapakarakteristik, yaitu: (1) termediasi (intermediate transmitter); (2) komunikatormelembaga (institutionalized); (3) pesanbersifat public; (4) komunikannyapublikdananonim(anonimous); (5) feedbacknyabersifattertunda (delayed); (6) prosespenerimaanpesannyaserempak; (7) cenderungbersifatsatuarah; dan (8) memilikiprosesgate keeping.
jurnalistik
Jurnalistik
  • CabangIlmuKomunikasi yang mempelajariketerampilanmencari, mengumpulkan, menyeleksi, danmengolahinformasi (peristiwa) sertamenyajikannyakepadakhalayakmelalui media massa (cetakdanelektronik).
  • Keahliandanketerampilanseseorangdalammencari, mengumpulkan, mengolahdanmenyebarkanberita, karangan, atauartikelkepadakhalayakseluas-luasnyadansecepat-cepatnya (Adinegoro)
  • A whole process of gathering facts, writing, editing and publishing news (Richard Weiner ).
  • Pekerjaanmengumpulkan, menulis, mengedit, danmenerbitkanberitadalamsuratkabar, dansebagainya (KKBI).
  • Kegiatanjurnalistikselaluterkaitdenganberita, sejakdaripengertianmengenaiberita, carapengumpulanberita, sertateknikpenulisannya.
jurnalisme
Jurnalisme
  • Jurnalismeadalahbentukkegiatandarijurnalistik.
  • Pelakujurnalismeialahjurnalisatauwartawan.
  • Wartawanmelakukantigakegitan: mengumpulkan(reporting),menulis(writing),danmengedit(editing).
  • Reportase(reporting): upayapengumpulaninformasibaru, penting, danrelevan yang menarikuntukdiketahuimasyarakat.
sembilan elemen jurnalisme
Sembilan ElemenJurnalisme

Jurnalismeharus:

  • memilikikewajibanpertamapadakebenaran.
  • memilikiloyalitaspertamapadawargamasyarakat.
  • memilikikedisiplinandalammelakukanverifikasi.
  • menjagaindependensidarisumberberita.
  • memfungsikandirinyasebagaipemantauindependenatassuatukekuasaantertentu.
  • menyediakanforum bagikritikdankomentarpublik.
  • mengupayakanhal yang pentingmenjadimenarikdanrelevan.
  • menjagaagar setiapberitakomprehensifdanproporsional.
  • membolehkanpraktisinyauntukmenggunakannuraninya

(Kovach danRosenstiel, 2004).

apa itu berita
ApaituBerita?
  • Any printable story which in the opinion of the editor will interest the readers of his paper or the audience of his broadcast (Thomas Elliot Barry )
  • Information which people urgently need (Turner Catledge).
  • A thorough and timely account of significant event (Thomas M.Pasqua).
  • Reports of anything timely which has importance, use, or interesting to a considerable number of persons in the publication’s audience (Edmund C.Arnold)
  • Laporantentangfakta, peristiwa/pendapatdan yang dipublikasikansecaraluasmelalui media massaperiodik (YB. Wahyudi).
slide8

Beritaadalahinformasibarudanpentingmengenaisuatuperistiwa, keadaan, gagasan, ataumanusia yang menarikuntukdiketahuimasyarakat.

  • Beritaadalahperistiwa yang dilaporkan. Peristiwaadalahkejadian yang telahberlangsung. Secarateknis, beritabarumunculhanyasetelahdilaporkan. Segalahal yang diperolehdilapangandanmasihakandilaporkan, belummerupakanberita, melainkanbarusekedarperistiwa.
peristiwa
Peristiwa
  • Berdasarkantiming (waktuterjadinya):
  • (1) Scheduled Event: peristiwa yang terencanaatauterprediksikanhampirsecarapasti.
  • (2) Non-Scheduled Event: peristiwa yang masihberhubungandenganscheduled eventtetapi yang diulas/diberitakanbukanscheduled eventitusendiri.
  • (3) Unscheduled Event: peristiwa yang samasekalitidakterprediksikanterjadinya.
fakta
Fakta
  • Bahanmentahberitadanmenjawabenampertanyaandasar (5W 1H).
  • What : apa yang terjadi,
  • When : bilamanaituterjadi,
  • Where : dimanaituterjadi,
  • Who : siapa yang terlibat,
  • How : bagaimanaituterjadi,
  • Why : mengapaituterjadi
slide11

Wartawan yang menontondanmenyaksikanperistiwabelumtentutelahmenemukanperistiwa.

  • Wartawansudahmenemukanperistiwasetelahiamemahamiprosesataujalancerita, yaitutahu APA yang terjadi; SIAPA yang terlibat; kejadiannya BAGAIMANA, KAPAN, dan DI MANA ituterjadi (prinsip 5W+1H).
  • Keenamitu yang disebutunsurberita.
slide12

Metodepenggalianfaktamaupunpenulisankembalielemen-elemenfaktatersebutpadadasarnyasangatlahtergantungpadarealitas yang menjadiobyeknya.

  • Secaraumum, adaduakategorirealitas:
  • Realitaspsikologis : berkaitandenganrealitaspewacanaanpendapatnarasumber (opinion bukanevent)
  • Realitassosiologis : berkaitandenganrealitasberupa “peristiwa” (event bukanopinion).
nilai berita news value
NilaiBerita (News Value)
  • Tidaksetiapkejadianbisadijadikanberita. Ada parameter tertentu yang harusdipenuhi agar suatukejadiandalammasyarakatdapatdiberitakan pers.
  • Parameter inidisebutsebagainews worthiness (kelayakanberita) yang secaraoperasionaldapatditelusurdari news values (nilaiberita) yang terkandungdalamrealitastersebut, meliputi:

1. Significance: kejadian yang berkemungkinanmempengaruhikehidupanorangbanyak/berakibatterhadapkehidupanpembaca.

2. Magnitude: kejadian yang menyangkutkuantitas yang berartibagikehidupan org banyak/ impikasinyadikuantifikasimenarikperhatian.

slide14

3. Timeliness: kejadian yang menyangkutkebaruan

4. Proximity: kejadian yang dekatsecaraemosionalmaupunlokalitas-geografisdengankehidupanpembaca.

5. Prominence: menyangkutketerkenalan

6. Human Interest: kejadian yang menyentuhperasaanpembaca.

pertimbangan lain n ilai berita
Pertimbangan lain  Nilaiberita:
  • Magnitude
  • Relevance
  • Important
  • Interesting
  • Nilaitanggungjawabnasional
  • Simplification
  • Predictability
  • Unexpectedness
  • Continuity and follow up
  • Personalitas/tokoh
  • Negativity
  • Curiosity
  • Understandable
  • Actuality and balance
  • Communication needs
kriteria layak tempo
KriteriaLayak Tempo
  • Kehangatan, sedangdibicarakandipublik (bobot: 10);
  • Tokoh, menyangkutorangterkenal (bobot:10);
  • Magnitude, skalabesarnyamasalah (bobot:10);
  • Pertamakali terjadi (bobot:10);
  • Relevansi, berkaitandengandampakberitaterhadap public (bobot:9);
  • Eksklusif, media satu-satunya yang mendapatbahanliputantersebut (bobot: 8);
  • Dramatis (bobot: 8);
  • Misi, menyebarluaskandemokratisasi, pluralisme (bobot: 8);
  • Prestisius, misalnyawawancaradengantokoh yang susahditemui, pentingataufenomenal (bobot:8);
  • Human Interest, kisah-kisahmenginspirasidanmenyangkutkemanusiaan (bobot: 8);
  • Tren, perkembangan yang terjadidimasyarakatmenyangkutgayahidupataufenomenasosial (bobot:7);
  • Unik, sesuatuperistiwa yang tidaklazimterjadi (bobot: 7);
  • Angle lain, misalnyasebuahperistiwa yang sudahbanyakdikupasternyataditemukan angle lain yang menarik (bobot: 7).
format pengemasan berita
Format PengemasanBerita

Dikategorikanmenjadidua:

  • (1) News Bulletin: format pemberitaan yang sangatmemperhitungkanactuality atautime concern.Dikemassecarasingkat, tidakdetail.
  • (2) News Magazine: format pemberitaan yang timeless. Dikemasdalam format panjang, detail featurisataubahkanin-depth.
kategorisasi news bulletin
KategorisasiNews Bulletin

(1) BeritaLangsung (Straight/Hard/Spot News)

  • Menyampaikankejadian-kejadianpenting yang secepatnyaperludiketahuiolehpembaca.
  • Straight: unsur-unsurterpentingdariperistiwatersebutharussesegeramungkindisampaikankepadapembaca.
  • Spot: wartawanberada/berhadapanlangsungdenganperistiwa yang dilaporkan.
  • Hard: peristiwayang dilaporkanadalahhal-hal yang sangatkrusial, mengejutkanataumendadakatauberdampakbesar.
  • Aktualiatas: unsurpentingdariberitalangsung tidakhanyamenyangkutwaktutetapijugasesuatu yang barudiketahui/ ditemukan (carabaru, idebaru, penemuanbaru, dll)
slide19

(2) BeritaRingan (Soft News):

  • Tidakmengutamakanunsur ‘penting’ melainkanunsur ‘menariknya’.
  • Kejadian yang diangkatlebihdilihatpadaunsurmanusiawinya.
  • Bahan yang ditulissebgaiberitaringanadalahelemen-elemenkejadianditingkatpermukaannya, tidakperlumelacaklatarbelakangnya.
  • Unsurmenarikdalamsebuahberitaringaninilebihditujukanuntuksekedarmenyentuhemosipembaca/pemirsa: keterharuan, kegembiraan, kasihan, kegeraman, kelucuan, kemarahandan lain-lain lewatkejadian-kejadiankonyol (komedi), dramatis, kontroversial, tragis/unik.
slide20

Duavarianberitaringan:

  • Beritaringan yang kejadiannyamenjadisampiran (side bar) dariperistiwapenting yang diberitakanlewatberitalangsung.
  • Beritaringan yang kejadiannyaberdirisendirisehinggatidakterkaitdengansuatuperistiwapenting yang bisadituliskansebagaiberitalangsung.
kategorisasi news magazine
KategorisasiNews Magazine

(3) BeritaKisah (Feature):

  • Laporankreatif yang ditujukanuntukmenyentuhperasaan, menambahpengetahuanlewatpenjelasan, rinci, lengkapsertamendalam (komprehensif).
  • Karanganfaktualmenarikdanjugamenghiburmengenaiperistiwa, persoalan, pikiran, proses, perkembangan, atauprofilperseorangan yang aktual.
  • Disajikandengangayamenulis yang lincahdan ‘cerdaskata’ (word smart).Nilai feature terletakpadaunsurmanusiawidandapatmenambahpengetahuanpembaca.
  • Bahasayang digunakanbiasanyacenderung prosaic. Feature tidakterikatolehaktualitas.
slide22

Jenis Feature

  • Profilfeaturemenceritakanperjalananhidupseseorang, bisa pula menggambarkansepakterjangorangtersebutdalamsuatukegiatandanpadakurunwaktutertentu. Profil feature tidakhanyaceritasuksessaja, tetapijugaceritakegagalanseseorang. Tujuannya agar pembacadapatbercerminlewatkehidupanorang lain.
  • How to do it featureadalahberita yang menjelaskan agar orangmelakukansesuatu. Informasidisampaikanberupapetunjuk yang dipandangpentingbagipembaca. MisalnyapetunjukberwisatakePulau Bali. Dalamtulisanitudisampaikanbeberapa tips prakatisruteperjalanan (darat, laut, udara), lokasiwisata, rumahmakandanpenginapan, perkiraanbiaya, kualitasjalan, keamanan, dan lain-lain.
slide23

Science featureadalahtulisanilmupengetahuandanteknologi yang ditandaiolehkedalamanpembahasandanobyektivitaspandangan yang dikemukakan, menggunakan data daninformasi yang memadai. Feature ilmupengetahuandanteknologidapatdimuatdimajalahteknik, komputer, pertanian, kesehatan, kedokteran, dan lain-lain. Bahkansuratkabar pun sekarangmemilikirubrik Science Feature.

  • Human interest featuremerupakan feature yang menonjolkanhal-hal yang menyentuhperasasaansebagaihal yang menarik, termasukdidalamnyaadalah hobby dankesenangan. Misalnyaorang yang selamatdarikecelakaanpesawatterbangdanhidupdihutanselamaduaminggu. Kakekberusia 85 tahun yang tetapmengabdipadalingkunganwalaupunhidupterpencildanmiskin.
slide24

(4) LaporanMendalam(In-depth Reporting):

  • Digunakanuntukmelaporkansebuahpermasalahan/kenyataansecaralebihlengkapdanberusahamengungkapjawabanmenyeluruhatasenampertanyaandasar: apa, dimana, bilamana, siapa, bagaimana, mengapa.
  • Reporter menekankanpengumpulanbahanuntukmenjawabbagaimana, mengapadanjugadampaksuatuperistiwaataukeadaan. Satuukuranberitaberkedalamansudahmenyajikanjawabanmenyeluruhialahbilamanatakadalagipertanyaanmunculdibenakpembaca.
slide25

Prosespeliputanlaporanmendalambiasanyadilakukanmelalui model peliputaninterpretive atauinvestigative. Model peliputaninterpretifdipergunakanjikawartawanberhadapandenganserangkaianperistiwa yang harusditafsirkanketerkaitanlogisnya.

  • Model peliputaninvestigatifdigunakanketikaadasejumlahpihakmenutupikejadiansebenarnyaataumenyembunyikansejumlahfaktamengenaitopik yang menyangkutkepentinganumum, terutamabilaadaindikasiperbuatansalah yang merugikan public danadaupayamenutup-nutupiperbuatantersebut.
bahasa jurnalistik
BahasaJurnalistik
  • Bahasajurnalistikadalahbahasa yang digunakanolehjurnalisdalammenulisberita. Bahasajurnalistikbersifatkhas, yaitusingkat, padat, sederhana, lugas, menarik, lancar, danjelas.
  • Terdapatempatprinsipretorikatekstualbahasajurnalistikyaitu (1) prinsipprosesibilitas (mudahdipahamipembaca); (2) prinsipkejelasan (menghindariambiguitas); (3) prinsipekonomi (menggunakanteks yang singkattanpamerusakdanmereduksipesan); (4) prinsipekspresivitas (teksdikonstruksiberdasarkanaspek-aspekpesan).
panduan penulisan berita
PanduanPenulisanBerita
  • Tulislahberita yang menarikdenganmenerapkangayabahasapercakapansederhana. Tulislahberitadengan lead yang bicara. Untukmenguji lead Anda ‘berbicara’ atau ‘bisu’, cobalahdenganmembacatulisan yang dihasilkan. Jikaandakehabisanafasdantersengal-sengalketikamembaca, maka lead Andaterlalupanjang.
  • Gunakankata/kalimatsederhana. Kalimatsederhanaterdiridarisatupokokdansatusebutan. Hindarimenulisdengankataketerangandananakkalimat. Gantikata-kata yang sulitatauasingdengankata-kata yang mudah. Bilaperluubahsusunankalimatataualinea agar didapattulisan yang ‘mengalir’. Ingat KISS (keep it short and simple).
slide28

Hindarikata-kataberkabut. Kata-kataberkabutadalahadalahtulisan yang berbunga-bunga, menggunakanistilahteknis, ungkapan yang asing yang tidakperludanungkapanumum yang kabur. Yang diperlukanragamBahasa Indonesia jurnalistikadalahkejernihantulisan(clarity).

  • Libatkanpembaca. Melibatkanpembacaberartimenulisberita yang sesuaidengankepentingan, rasa ingintahu, kesulitan, cita-cita, mimpidanangan-angan. Tapiingat: jangansampaiterjebakmenulisdengangayamengguruiataumenganggapentengpembaca. Melibatkanpembacaberartimengubahsoal-soal yang sulitmenjaditulisan yang mudahdimengertipembaca. Melibatkanpembacajugadidapatdenganmenulissesuai rasa keadilan yang hidupdimasyarakat.
slide29

Gantilahkatasifatdengankatakerja. Baca kalimatini: “Seorangperempuan yang kelelahanbekerjadisawahnya.” Bandingkandengan: “Seorangperempuantuamembajak, kepalanyamenunduk, nafasnyatersengal-sengal!”

  • Gunakankosakata yang tidakmemihak. Baca kalimatini: “Seorang ayah memerkosaanakgadisnyasendiri yang masihberusia 12 tahun.” Bandingkandengan: “Perkosaanmenimpaanakagadis yang berusia 12 tahun”.
  • Hindaripemakaianeufemismebahasa. Baca kalimat: “SelamamusimkemarauterjadirawanpangandiGunungKidul.” Bandingkandengan: “SelamamusimkemarauterjadikelaparandiGunungKidul.”
hal hal penting
Hal-Hal Penting
  • What’s the story (Beritaapa?): SebelumAndamenuliskansebuahkata, Andaharustahuapaberitanyadandarisudut/angle manaandaakanmenulisnya.
  • 5-W: Who, what, when, where, why? Apakahandatelahmenjawabpertanyaansemuanyatadi. Jikasudahberartiandasudahdalamjalur yang betul.
  • Fakta:Harusselaluingattentanghalini. Tulislahapa-apa yang andaketahui, bukan yang andaperkirakanataupraduga. Gossip ataudesas-desuslebihbaikhanyaberedardiwarung-warungsajajangandibawa-bawakedalamberita.
slide31

Attribution: Cara yang baikuntukmenghindaridesas-desus agar tidakmunculdiberita, yaitu: pastikanbahwaAndapunyasumber yang bisadiandalkandariinformasi yang disiarkan. Jikatidakpunyajangandibaca.

  • Logical structure (memilikisusunan yang wajar): Selalumenyajikanurutan yang jelas. DiingatselaluuntukselalumenulisberitaseakanAndatengahmengatakannyakepadaseorangteman.
  • Satuide per-kalimat:Janganterlalubanyakmenjejalkankedalamtiapkalimatnya.
slide32

Jargon: Para politikusdanpakarseringmenggunakanya. Tugaskitauntukmenerjemahkankedalamistilah-istilahsederhana yang mudahdimengerti. Andamungkinakanpahamdenganistilah “saldo deficit pembayaran’, tetapibelumtentupembacaAnda.

  • Bahasa:Gunakanlahbahasa yang sudahbiasaandapergunakanjikasedangberbicara. Ingattujuanandaadalahuntukmemberitahupendengartidakbertujuanuntukmenunjukkankepintarananda.
  • Cliches (istilahklise):Harusdihindaripenggunaanistilah-istilahklise. Menggambarkanapa yang hanyaandalihatdansesuaifaktaadalahlebihbagusdaripadaandamemakaiungkapan-ungkapan yang sudahdipakai.
kriteria berita yang baik
KriteriaBerita yang Baik
  • Akurasi, kaidah-kaidahpenulisanberitadalampengertian modern, yaitulaporanharusbersifat factual, akurasiobyektif, danberimbang. Sebagaipenjabaranakurasimakamuncul formula 5W+1H (what, who, when, where, why, dan how).
  • Objektif, beritaharusmerupakanlaporanfaktualtentangsuatuperistiwasepertiapaadanyatetapitentusajasejauhhalinidimungkinkan, sebabwartawan pun memilikiketerbatasan. Untukmengejarobjektivitasinikemudianmuncullaporankomprehensifdanlaporaninvestigatif.
  • Berimbang(balanced),beritaadalahlaporan yang objektiftermasuktidakmemihakkepentingankelompoktertentu. Sifatberimbanginiperludijaga agar beritatidakmenyesatkanpembacadantidakdigugatolehpihak yang merasadirinyadirugikan.
komponen tulisan
KomponenTulisan

Unsur-unsursebuahberitasecarastrukturalpadadasarnyadapatdibedakanmenjadi:

JUDUL/HEADLINE : judul (fungsinyauntukmenolongpembaca agar segeratahutentangperistiwa yang diberitakan, biasanyadikemasdalamfont yang berbedadaritubuhberitanya). Judulmengandungpengertian 2-5 kata yang disajikansecararingkassertamengasosiasikandengansesuatu yang diingatpembaca. Bersama sub judul, kicker, daneyecacther – mencerminkanisitulisan: sangatmenarik/baru/penting/luarbiasa

BY LINE : namajurnalis.

DATE LINE : nama media, tanggalkejadianatautempatkejadian.

slide35

LEAD : disebutsebagaiterasberitadanditulispadaparagrafpertama. Lazimnyamengandungsubstansi yang samadengan focus materijudul: sangatmenarik/baru/penting/luarbiasa. Lead adalahduahinggatigakalimat yang mengintisarikanberitaatauartikelsehinggamembaca lead, pembacamenarikuntukmembacanya.

BODY : terdiridari detail peristiwaataurealitas yang diberitakan. Badanberitaatautubuhberita, adalahberisisaijansecaralengkapdaribahan yang akanditulis. Runut, denganmengikutialurstrukturtulisan—bagaikan spiral—yang lazimdalamkaryajurnalistik.

slide36

EKOR (ending): berisibeberapakalimat yang menyimpulkandariberitaatauartikel. Biasanya ending ataupenutuppadaartikel, selaluberisi saran, solusimaupunrekomendasiuntukpembaca. Menarikdanmengejutkan (bilatulisanberstruktur delayed-delayed drop). Bilatulisanberstrukturpiramidaterbalik, inisekedarinformasipelengkap yang tidakbegitupenting, tetapimungkinmasihperludiketahuipembaca.

struktur berita
StrukturBerita
  • Piramidaterbalik (inverted pyramid)
  • Delayed drop (kejutanperistiwa ‘ditunda’ sampaibagiantengahtubuhtulisan
  • Delayed-delayed drop (kejutanperistiwa ‘ditunda’ sampaiekortulisan
  • Kronologi(dibangundenganmenampilkanurutanperistiwa yang seluruhnya dramatis sejakawalsampaiakhirtulisan)
slide38

Model PiramidaTerbalik

  • Semakinkebawahelemen-elemenfaktaditempatkanmakasemakinbersifatkomplementerelemen-elementersebut. Informasi paling baru, atau paling penting, atau paling menarikditempatkanpadaalineapertasebagaiterasberita (lead, intro) agar dapatsegeramenarikperhatiankhalayak.
  • Bagianpenulisanterpentingadalahpadabagianawal yang dikenalsebagai lead. Lead yang baikharusmampudengancepatmemberigambaranpadapembacaapa yang terjadi. Makin kebawah, tulisanitumenjadimakin ‘tidakpenting’. Unsur-unsurkunciharusdiletakkandibagianawal.
  • Biasanyadigunakandalamsebuahberitakeras (hard news-breaking news) yang mementingkankecepatan.
slide39

KepalaBerita / Headline / Lead:berisikesimpulanatauklimaksdarisebuahberita. Padabagianini, disampaikanapa yang menjadiintidariberita yang akandisiarkan.

  • Setting Petistiwa:paparanberita, yang berisiapakejadiannya, siapapelakuutamanya, dimanaterjadinya, padakesempatanapa.
  • Detail Berita:berisitentang data-data ataufakta-faktapendukung
  • Background / LatarBelakang: berfungsiuntukmelengkapipemberitaan. Dalambagianinikitabisaberceritalebihjelasbagaimanaperistiwaitubisaterjadi. Kita bisamenggunakanperbandingan, mengkontraskandenganperistiwa lain, sehinggaakannampakperbedaanberitainidarisekedarperistiwabiasa.
  • Rincian Lain:bisadimanfaatkanuntukmemberikantekananpada point-point pentingdariberita, ataukitajugabisamengulangiintiberitanamundengantidakmenggunakankata-kata yang sama.

Piramidaterbalikseringdigunakan media cetak (harian) danelektronik, karenadenganbentukitu, penulismenuliskanlaporandenganmengutamakanhal yang terpenting. Cara itumenguntungkan, sebabakanmempermudahtim editing dalammelakukanpemotongankataataukalimatapabila deadline waktusangatdekat, sehinggabentukpiramidaterbalikdigunakan media cetakharian yang waktu dead linenyacukupsingkatdanterbatas.

slide40

BentukBeraturan(Block)

  • Model inimenunjukkanbahwasemuabagiansamapentingnya. Artinya, seluruhmateriberita—dariawalsampaiakhirkejadian—terusmenerussangatmenarikatau dramatis. Dalam model iniseringterdapat sub-juduldalambagianbody. Model inicocokuntukmenyajikanberita yang memuatkronologisebuahperistiwa.
  • Bentukinidigunakanpenulistanpamelihathalterpentingnamun, penuliscukupmenulissesuaiapa yang dikehendakinya. Sehinggabentukberaturansangattepatdigunakandalammenyusunartikel, karenanyabentukitulazimdigunakan media cetakmajalhdan tabloid yang memiliki dead line yang panjang (seminggu, duaminggu, sebulanmaupuntriwulan).
slide41

Delayed Drop

  • Informasi paling menarikditempatkanpadaalineadibagiantengahkonstruksiberitaataupadaalineahampirakhir. Tetapi, terasberitaharustetapdapatmenarikperhatiankhalayak.

Delayed-delayed Drop

  • Informasi paling menarikditempatkanpadaalineaterakhirsebagaikejutanpadaekorberita (ending). Jugaterasberitaharustetapdapatmenarikperhatiankhalayak. Untukkonstruksiberita delayed-delayted drop, bagianterakhiratauekor (ending) beritadapatberisimateriinformasi ‘paling menarik’ walaupunmungkinbukan yang paling pentingataubukaninformasibaru.

PiramidaTidakTerbalik

  • Materiberitaapa pun tidakmungkindisusundalambentukpiramidatidakterbalik, karenatidakakanmenarikperhatianpadaawalmembacaberitaitu. Teras (intro/lead) beritapadaumumnyamengandunginformasi: paling baru, paling penting, atau paling menarik.
angle sudut pandang
Angle (Sudut Pandang)
  • Sebuahfaktabisadilihatdariberbagaisudutpandang. Angle adalahsuduttekananberita. Bilatopikberitamerupakanmasalahpokok, angle ialahrangkaianpersoalandalamcakupanmasalahpokoktersebut.
  • Angle dapatdibagidalamtigakurunwaktu: angle masalalu, masakini, danmasadepan. Angle menjadipenting agar tulisanterfokus; untukmemecahberitapanjangmenjadiberita-beritapendek yang salingberkait; untukmemilahpenulisanberitamulaidariprioritastertinggihinggaprioritasterendah.
  • Dalammenyusunberita, kitaharusselalumemulaidariunsur yang terpenting (headline), diikuti data-data ataufakta-fakta lain yang tingkatkepentingannyaadadibawah headline, berturut-turutdari yang paling pentinghingga yang kurangpenting.
lead berita
Lead Berita
  • Lead beritaataukalimatpembuka, adalahkata-kata yang membentuktautankalimatdiawalberitakita. Semakinmenarikpemilihan, penggunaandanpenyusunankata-katanya, peluangberitakitauntukdidengarolehmasyarakatakanmenjadisemakinbesar.
  • Lead harusditulisdengansederhana, tidakrumit, tidakmembingungkan, apalagisampaimembuatpendengarkitaengganuntukmenyimak. Jangansekali-kali membuat lead denganmenjabarkan 5W 1H dalamsebuahkalimatawal. Plihsalahsatudarielemen 5W yang paling menarik. Bisasajadalamsebuah lead beritakitamembahassoal Who-nya, What-nya, Why-nya, When-nyaatau Where-nya.
  • Direct Leadadalahkalimatataualineapertamatulisan yang langsungmengangkatmasalahpokokdenganmengungkapkanfaktapentingdanbaru. Beritabiasa (straight news) umumnyamemakaidirect lead.
  • Delayed Lead adalahkalimatataualineapertama yang isinyatidaksegeramengungkapkanmasalahpokoktulisantetapidisajikandengangayakreatifuntukmembangkitkan rasa ingintahupembaca. Featuredannews featurememakaidelayed lead.
tips membuat lead berita
Tips Membuat Lead Berita
  • Janganmenjejalkanterlalubanyakinformasidalam lead berita. Seringkali lead panjangnyahanyasatukalimatmaksimal 20 kata. Informasi, data ataupunfakta-fakta lain yang tidakterpilihsebagai lead, bisakitatempatkandalamisiberita.
  • Hindarimembuat lead beritamenggunakankalimattanya.
  • Janganmeletakkaninformasikuncipadaduaatautigakatadiawal lead berita, agar pendengartetaptertahanuntukmengetahuipesanapa yang akankitasampaikan. Namundemikian, jangan pula meletakkaninformasikunciterlalujauhdibelakangkalimat.
  • Hindarimenggunakannamaatauistilahasing yang tidakdikenalpendengardiawal lead. Sebaiknyakitamendahuluinyadenganpenjelasansingkat.
  • Janganmenggunakananakkalimatdalammembuat lead.
  • Janganmengawali lead denganmenyebutkanlokasi. Hal iniakanmengurangikemampuanpendengarberimajinasi, danakanmenimbulkanpengulanganpengulangan yang tidakperlu.
slide45

Hindarimencantumkanangka-angkarumitpada lead, karenaangka-angkaitutidakakanberdampakbagipendengarkita. Selainituperludiingat, bahwasetiap kali kitamencantumkanangka-angkaharusselaludiikutidenganpenjelasan.

  • Hindaripenggunaankata “hariini” pada lead berita. Pendengarsudahmengetahuijikaapa yang kitasampaikanadalahkejadianhariini. Gunakanvariasiketeranganwaktumisalnya: pagitadi, nantimalam, satu jam yang lalu, dua jam lagidanlainnya.
  • Janganmembuatpendengarmenungguterlalu lama untukmengetahuidimanalokasikejadiansebuahperistiwa.
  • Jikamencantumkankutipanpernyataannarasumber, kitaharusmeletakkansipembuatpernyataan (belumtentunama) didepan lead. Pembuatpernyataanmemilikiartipentingataspernyataan yang dibuatnyadanmungkinmasihbisadiperdebatkan.
jurnalisme investigasi
JurnalismeInvestigasi
  • Jurnalismeinvestigasiadalahsuatubentukpeliputanberdasarkaninisiatifdanhasilkerjawartawanterhadapmasalah-masalahpenting yang dirahasiakanseseorangatauorganisasi.
  • Laporaninvestigasibukanlaporanbiasa. Iabagaikanpisautajam yang siapmembedahkeburukansiapa pun yang terlibatskandal. Iajugabisasepertimatadewa yang siapmenembuspekatnyaruanggelap yang menyimpanbanyakrahasia.
  • Tigaelemendasarjurnalismeinvestasi: (1) DilakukanolehWartawanitusendiri. (2) Merupakaninformasirahasiaygdisembunyikandariperhatianpublik. (3) Masalahyang diungkapkanmemilikiartipentingdimatamasyarakat/ pendengarnya.
  • Jurnalismeinvesigasidimulaidarisuatuanggapan/ kecurigaanthat someone has done something wrong! Berdasarkan ‘info’ ataupengamatanjelisi reporter sendiriygmenciumketidakberesanmengenaisuatuhal.
langkah langkah reportase investigasi
Langkah-LangkahReportaseInvestigasi
  • Memunculkanide: bisadari saran seseorang, membaca, ataumemanfaatkanpotonganberitadanmengembangkansudutpandang lain darisebuahberita, kemudianmelakukanobservasilangsung.
  • Studikelayakanuntukmelihatberbagaihalangan yang harusdiatasi, atauhal-hal yang perludisiapkan. Setelahitumerancanganggotatimdanmelihatkemungkinanadanyatekananterhadap media. Perlumenjagakerahasiaandari media lain.
  • Go-No-Go Decision: menghitunguntung-rugihasilinvestigasi.
  • Basebuilding: mencaridasarpijakdalammenganalisiskasus.
  • Planning: tahappengumpulandanpenyusunaninformasisertapembagiantugas.
slide48

Original Research berupapenelusuran data tekstual (sumbersekunderdan data primer) danwawancaradengannarasumber.

  • Reevaluation: memutuskandihentikan, ditunda, ataudilanjutkan.
  • Filling the Caps: melengkapi data daninformasi yang masihbolong (wawancaramaupundokumentambahan).
  • Final Evaluation: tahapinimengukurapakahhasilinvestigasimemanglayakdipublikasikan. Jugamenyangkutakurasi, hakprivasiseseorang, keamanannarasumber yang tidakmaudisebutkan.
  • Writing and re-writing.
  • Publication dan Follow-Up Stories

(Paul N Williams)