rahmatini bagian farmakologi fakultas kedokteran universitas andalas n.
Download
Skip this Video
Loading SlideShow in 5 Seconds..
Rahmatini Bagian Farmakologi Fakultas Kedokteran Universitas Andalas PowerPoint Presentation
Download Presentation
Rahmatini Bagian Farmakologi Fakultas Kedokteran Universitas Andalas

Loading in 2 Seconds...

play fullscreen
1 / 27

Rahmatini Bagian Farmakologi Fakultas Kedokteran Universitas Andalas - PowerPoint PPT Presentation


  • 390 Views
  • Uploaded on

AMUBISID & ANTI MALARIA. Rahmatini Bagian Farmakologi Fakultas Kedokteran Universitas Andalas. ANTI PARASIT. Terdiri dari : 1.Antelmentik ( obat cacing ) 2.Amubisid (anti amuba ) 3.Anti malaria 4.Anti jamur. AMUBISID. Klasifikasi : 1.Amubisid jaringan

loader
I am the owner, or an agent authorized to act on behalf of the owner, of the copyrighted work described.
capcha
Download Presentation

PowerPoint Slideshow about 'Rahmatini Bagian Farmakologi Fakultas Kedokteran Universitas Andalas' - usoa


An Image/Link below is provided (as is) to download presentation

Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author.While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server.


- - - - - - - - - - - - - - - - - - - - - - - - - - E N D - - - - - - - - - - - - - - - - - - - - - - - - - -
Presentation Transcript
rahmatini bagian farmakologi fakultas kedokteran universitas andalas

AMUBISID & ANTI MALARIA

Rahmatini

BagianFarmakologiFakultasKedokteranUniversitasAndalas

anti parasit
ANTI PARASIT

Terdiridari :

1.Antelmentik (obatcacing)

2.Amubisid (anti amuba )

3.Anti malaria

4.Anti jamur

slide3

AMUBISID

Klasifikasi :

1.Amubisid jaringan

2.Amubisid luminal

3.Amubisid luminal & jaringan

slide4

AMUBISID JARINGAN

  • Emetin, klorokuin
  • Emetin E histolytica
  • Efeksamping : reaksilokal & sistemik
  • Pemberian : intra muskular
  • Sudahmulaiditinggalkan, hanyadiberikanbilametronidazoltidakefektifataudikontraindikasikan.
slide5

AMUBISID LUMINAL

  • Derivat 8 hidroksikuinolin
  • Berefekamubisidlangsung,hanyabekerjapadaamubadalam lumen usus.
  • Efeksampingterpenting : SMON  Subacutemyelooptic
  • neuropathy (jepang
slide6

AMUBISID LUMINAL & JARINGAN

Metronidazol

  • Efektifterhadapberbagaijenisamuba, termasuk T. vaginalis
  • Absorpsibaik, T ½ :8 – 10 jam
  • Efeksamping : Keluhansalurancerna, sakitkepala, gangguandarahdll.
slide7

METRONIDAZOL

  • Dapatmenyebabkangangguan

darah, pemberianmetronidazol >7 hariPemeriksaanLeukositberkala.

  • Kontraindikasi : pasienriwayatpenyakitdarah & gangguan SSP, trimester I kehamilan
  • Indikasi : amubiasis, trikomoniasis & infeksibakterianaerob.
slide8

METRONIDAZOL

Indikasi lain :

  • Profilaksispascabedah abdomen
  • Infeksipelvik
  • Kolitispseudomembranosa
  • Amubiasisdewasa:

3 X 750 mg/hari, 5 – 10 hari

  • Amubiasisanak :
  • 35-50 mg/kgBB/3 dosis
e histolytica
E histolytica
  • Gambar :Entamoebahistolytica yang tertanampadaselinang. Dimanaparasitinimelepaskansuatu protein yang membentuksuatulubang yang disebutamoebapores
slide10

PENUTUP

  • Hilangnyagejalaklinikbelummerupakanjaminanpasiensembuhdariamubiasis.
  • Pengobatanamubiasisdinyatakanberhasilbila:
  • Padapemeriksaanlaboratoriumberkalaselama 6 bulantidakditemukanbentukhystolyticadankista.
  • Cegahinfeksiulang, peningkatanhigiene & sanitasilingkungan.
slide11

Pengobatanterhadapkarierkista .

Diet karbohidrat & protein yang mudahdicerna.

Terapisimtomatik.

slide12

MALARIA

  • 1. Malaria tropika P. falciparum
  • 2. Malaria tersiana 
  • P. vivax & P ovale
  • 3. Malaria kuartana  P. malariae
slide14

Manusia hospesperantara

Nyamuk anopheleshospesdefinitif

slide15

KLASIFIKASI

1.Skizontosid jaringandandarah

2. Gametositosid

3. Sporontosid

slide16

PENATALAKSANAAN

  • KeputusanMenkes RI tentangPedomanpenatalaksanaan malaria.

Latarbelakang :

  • Resistensi P falciparumterhadapklorokuinsejaktahun 1973 diKaltim, 1990 diseluruhprovinsi,
  • ResistensiSulfadoksin – Pirimetamin

( SP) dibeberapatempatdi Indonesia.

slide17

PENATALAKSANAAN

Pemerintahmerekomendasikanpilihanpenggantiklorokuin & SP terhadap P falciparum

artemisinin combination therapy

slide18

M.VIVAX & OVALE

  • Malaria vivax & ovaleadalah :

 Klorokuin + Primakuin

Klorokuin 25 mg/KgBB, 1 x / hariselama 3 hari,

Primakuin 0,25 mg/ kgBB/ hariselama 14 hari.

  • Pilihan II Kina + Primakuin
  • Kina 10 mg/KgBB/kali,3xsehari slm 7 hr
  • Primakuin 0,25 mg/KgBB (slm 14 hr)
slide19

MALARIA FALCIPARUM

Malaria falciparum

Artesunat + Amodiakuin +Primakuin

3 hari Per oral

Artesunat 4 mg/kgBB

Amodiakuin 10 mg/kgBB.

Primakuin0,75 mg/KgBB

  • Lini 2
  • Kina + Doksisiklin + Primakuin
  • Kina + tetrasiklin + Primakuin
slide20

M.MALARIAE

Klorokuinselama 3 hari

Malaria mix :

Artesunat + Amodiakuin + Primakuin

slide21

MALARIA BERAT

1.Tindakan umum

2.Terapi simtomatik

3.Pemberian obat anti malaria

Artemisininparenteral

4.Penanganan komplikasi

slide22

KLOROKUIN

  • Tidakdigunakanrutin, karenaefeksampingagranulositosis yang fatal & toksikpadahati.
  • Sangatefektifmengatasiseranganakut malaria.
  • Absorpsilengkap & cepat.
  • Pemakaianhati-hatipada : penyhati, gangguansalcerna, neurologik & darah.
slide23

AMODIAKUIN

  • Strukur & aktivitasmiripklorokuin
  • MasihcukupefektifuntukP.falciparum
  • Tidakdirekomendasikanuntukprofilaksiskarenadapatmenyebabkan hepatitis toksik & agranulositosis
slide24

KINA

  • Efektifuntuk P falciparum yang resistenklorokuin & SP.
  • Dapatmenyebabkansinkonismus yang reversibel
  • Kurangefektif & lebihtoksik
slide25

ARTEMISININ

  • Skizontosiddarahefektif in vitro & in vivo
  • Mekanismekerja : menghambatsintesa protein.
  • Relatifaman, efeksamping : salcerna .
  • Kontraindikasi : wanitahamil.
slide26

KEMOPROFILAK

Mengurangiresikoterinfeksi, sehinggabilaterinfeksigejalalebihringan.

Ditujukankepadaorangygpergikedaerahendemisdalamwaktutidak lama

slide27

KEMOPROFILAK

  • Kemoprofilakuntuk Plasmodium falciparum:
  • Doksisiklin 2 mg/kgBB hr 4-6 minggu
  • Kemoprofilak Plasmodium vivak:
  • Klorokuin 5 mg/KgBBtiapminggu
  • Obatdiminum 1 minggusebelummasukdaerahendemissampai 4 minggusetelahkembali