rahmatini bagian farmakologi fakultas kedokteran universitas andalas n.
Skip this Video
Loading SlideShow in 5 Seconds..
Rahmatini Bagian Farmakologi Fakultas Kedokteran Universitas Andalas PowerPoint Presentation
Download Presentation
Rahmatini Bagian Farmakologi Fakultas Kedokteran Universitas Andalas

Loading in 2 Seconds...

play fullscreen
1 / 27

Rahmatini Bagian Farmakologi Fakultas Kedokteran Universitas Andalas - PowerPoint PPT Presentation

  • Uploaded on

AMUBISID & ANTI MALARIA. Rahmatini Bagian Farmakologi Fakultas Kedokteran Universitas Andalas. ANTI PARASIT. Terdiri dari : 1.Antelmentik ( obat cacing ) 2.Amubisid (anti amuba ) 3.Anti malaria 4.Anti jamur. AMUBISID. Klasifikasi : 1.Amubisid jaringan

I am the owner, or an agent authorized to act on behalf of the owner, of the copyrighted work described.
Download Presentation

PowerPoint Slideshow about 'Rahmatini Bagian Farmakologi Fakultas Kedokteran Universitas Andalas' - usoa

Download Now An Image/Link below is provided (as is) to download presentation

Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author.While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server.

- - - - - - - - - - - - - - - - - - - - - - - - - - E N D - - - - - - - - - - - - - - - - - - - - - - - - - -
Presentation Transcript
rahmatini bagian farmakologi fakultas kedokteran universitas andalas




anti parasit

Terdiridari :

1.Antelmentik (obatcacing)

2.Amubisid (anti amuba )

3.Anti malaria

4.Anti jamur



Klasifikasi :

1.Amubisid jaringan

2.Amubisid luminal

3.Amubisid luminal & jaringan



  • Emetin, klorokuin
  • Emetin E histolytica
  • Efeksamping : reaksilokal & sistemik
  • Pemberian : intra muskular
  • Sudahmulaiditinggalkan, hanyadiberikanbilametronidazoltidakefektifataudikontraindikasikan.


  • Derivat 8 hidroksikuinolin
  • Berefekamubisidlangsung,hanyabekerjapadaamubadalam lumen usus.
  • Efeksampingterpenting : SMON  Subacutemyelooptic
  • neuropathy (jepang



  • Efektifterhadapberbagaijenisamuba, termasuk T. vaginalis
  • Absorpsibaik, T ½ :8 – 10 jam
  • Efeksamping : Keluhansalurancerna, sakitkepala, gangguandarahdll.


  • Dapatmenyebabkangangguan

darah, pemberianmetronidazol >7 hariPemeriksaanLeukositberkala.

  • Kontraindikasi : pasienriwayatpenyakitdarah & gangguan SSP, trimester I kehamilan
  • Indikasi : amubiasis, trikomoniasis & infeksibakterianaerob.


Indikasi lain :

  • Profilaksispascabedah abdomen
  • Infeksipelvik
  • Kolitispseudomembranosa
  • Amubiasisdewasa:

3 X 750 mg/hari, 5 – 10 hari

  • Amubiasisanak :
  • 35-50 mg/kgBB/3 dosis
e histolytica
E histolytica
  • Gambar :Entamoebahistolytica yang tertanampadaselinang. Dimanaparasitinimelepaskansuatu protein yang membentuksuatulubang yang disebutamoebapores


  • Hilangnyagejalaklinikbelummerupakanjaminanpasiensembuhdariamubiasis.
  • Pengobatanamubiasisdinyatakanberhasilbila:
  • Padapemeriksaanlaboratoriumberkalaselama 6 bulantidakditemukanbentukhystolyticadankista.
  • Cegahinfeksiulang, peningkatanhigiene & sanitasilingkungan.

Pengobatanterhadapkarierkista .

Diet karbohidrat & protein yang mudahdicerna.




  • 1. Malaria tropika P. falciparum
  • 2. Malaria tersiana 
  • P. vivax & P ovale
  • 3. Malaria kuartana  P. malariae

Manusia hospesperantara

Nyamuk anopheleshospesdefinitif



1.Skizontosid jaringandandarah

2. Gametositosid

3. Sporontosid



  • KeputusanMenkes RI tentangPedomanpenatalaksanaan malaria.

Latarbelakang :

  • Resistensi P falciparumterhadapklorokuinsejaktahun 1973 diKaltim, 1990 diseluruhprovinsi,
  • ResistensiSulfadoksin – Pirimetamin

( SP) dibeberapatempatdi Indonesia.



Pemerintahmerekomendasikanpilihanpenggantiklorokuin & SP terhadap P falciparum

artemisinin combination therapy



  • Malaria vivax & ovaleadalah :

 Klorokuin + Primakuin

Klorokuin 25 mg/KgBB, 1 x / hariselama 3 hari,

Primakuin 0,25 mg/ kgBB/ hariselama 14 hari.

  • Pilihan II Kina + Primakuin
  • Kina 10 mg/KgBB/kali,3xsehari slm 7 hr
  • Primakuin 0,25 mg/KgBB (slm 14 hr)


Malaria falciparum

Artesunat + Amodiakuin +Primakuin

3 hari Per oral

Artesunat 4 mg/kgBB

Amodiakuin 10 mg/kgBB.

Primakuin0,75 mg/KgBB

  • Lini 2
  • Kina + Doksisiklin + Primakuin
  • Kina + tetrasiklin + Primakuin


Klorokuinselama 3 hari

Malaria mix :

Artesunat + Amodiakuin + Primakuin



1.Tindakan umum

2.Terapi simtomatik

3.Pemberian obat anti malaria


4.Penanganan komplikasi



  • Tidakdigunakanrutin, karenaefeksampingagranulositosis yang fatal & toksikpadahati.
  • Sangatefektifmengatasiseranganakut malaria.
  • Absorpsilengkap & cepat.
  • Pemakaianhati-hatipada : penyhati, gangguansalcerna, neurologik & darah.


  • Strukur & aktivitasmiripklorokuin
  • MasihcukupefektifuntukP.falciparum
  • Tidakdirekomendasikanuntukprofilaksiskarenadapatmenyebabkan hepatitis toksik & agranulositosis


  • Efektifuntuk P falciparum yang resistenklorokuin & SP.
  • Dapatmenyebabkansinkonismus yang reversibel
  • Kurangefektif & lebihtoksik


  • Skizontosiddarahefektif in vitro & in vivo
  • Mekanismekerja : menghambatsintesa protein.
  • Relatifaman, efeksamping : salcerna .
  • Kontraindikasi : wanitahamil.


Mengurangiresikoterinfeksi, sehinggabilaterinfeksigejalalebihringan.

Ditujukankepadaorangygpergikedaerahendemisdalamwaktutidak lama



  • Kemoprofilakuntuk Plasmodium falciparum:
  • Doksisiklin 2 mg/kgBB hr 4-6 minggu
  • Kemoprofilak Plasmodium vivak:
  • Klorokuin 5 mg/KgBBtiapminggu
  • Obatdiminum 1 minggusebelummasukdaerahendemissampai 4 minggusetelahkembali