1 / 10

Introduction to Bioinformatics

Introduction to Bioinformatics. Lisa Mullan, HGMP-RC. What is it?. Bioinformaticians -. Develop bioinformatics tools (software). Bioinformatics users -. Use bioinformatics tools. What are these tools?. Similarity searching. Primer design. Nucleic acid translation. Sequence alignment.

Download Presentation

Introduction to Bioinformatics

An Image/Link below is provided (as is) to download presentation Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author. Content is provided to you AS IS for your information and personal use only. Download presentation by click this link. While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server. During download, if you can't get a presentation, the file might be deleted by the publisher.

E N D

Presentation Transcript


  1. Introduction to Bioinformatics Lisa Mullan, HGMP-RC

  2. What is it? Bioinformaticians - Develop bioinformatics tools (software) Bioinformatics users - Use bioinformatics tools

  3. What are these tools? Similarity searching Primer design Nucleic acid translation Sequence alignment Pattern finding Gene prediction Structure prediction

  4. Where do I find them? http://www.ebi.ac.uk http://www.sanger.ac.uk http://www.hgmp.mrc.ac.uk http://www.ncbi.nlm.nih.gov http://www.expasy.ch http://pbil.univ-lyon.fr On the web Or you can download packages of programs onto your own computers

  5. Searching for a sequence Entrez http://ww.ncbi.nlm.nih.gov/Entrez SRS Most sites use a “sequence search engine”

  6. FASTA Format >Sequence description MNEGDTHYYNKLPPDSEFGDNHVVILCNMFFHRTEYWWDFCDVNMVCDHGGSAEQQR Text (plain) Format MNEGDTHYYNKLPPDSEFGDNHVVILCNMFFHRTEYWWDFCDVNMVCDHGGSAEQQR What does it look like?

  7. Save it as a txt file - Notepad, Teachtext, ASCII format Cut and paste into web based tools - BLAST, PeptideMass Input for programs as part of a larger package - EMBOSS, GCG and what do I do with it?

  8. Human Genome Mapping Project – Resource Centre Funded by the Medical Research Council Provide biological and bioinformatics support to the academic community Software development and biological research

  9. A word about X DOS MacOS UNIX Personal Computers Apple Macintosh Workstations X translates “unix-speak” into DOS and MacOS http://www.hgmp.mrc.ac.uk/Registered/Webapp/vnc/

  10. (root) people/ data/ mrna41/ mrna01/ lmullan/ Basic UNIX commands cp – copy ls – list (directory contents) seq.fasta mv – move or rename rm – delete (remove) cd – change directory pwd – print working directory mkdir – make a directory rmdir – remove (delete) a directory

More Related