130 likes | 441 Views
Defensive Proteins . Hadley Jones & Jamie Levitt. What are they?. Destroy disease causing viruses and bacteria Fight against antigens (substance that stimulates the immune system to produce antibodies) Specific shape that binds with foreign substances to attack it
E N D
Defensive Proteins Hadley Jones & Jamie Levitt
What are they? • Destroy disease causing viruses and bacteria • Fight against antigens (substance that stimulates the immune system to produce antibodies) • Specific shape that binds with foreign substances to attack it • Send signals to other parts of the immune system • Examples: Antibodies and complement proteins
How are they made? • In the cell- transcription and translation provide the genes that make the amino acid sequence • tRNA- assembles the protein until the ribosome encounters a “stop” codon • Protein synthesis- puts the amino acids together that make up defense proteins • The cell’s genes represent the amino acid arrangement to make the protein function properly
Inside the Cell…. • The genes from DNA are expressed through transcription and translation • Transcription- the information in a gene’s DNA is transferred to the RNA in the nucleus • Translation- takes place in the cytoplasm; the ribosomes read the sequence of mRNA bases • tRNA- assembles the protein by connecting codons in protein synthesis
SHAPE DETERMINES FUNCTION • Antibodies- Y-shaped so they can attach onto foreign substances (antigens) • Highly specialized to recognize specific antigens • Binding site on each “arm” of the Y • Each binding site is specifically shaped (lock and key fitting) • Only antigens that match that binding site will fit and get destroyed
Immunoglobulin • Made up of glycoprotein molecules (produced by plasma B cells) in response to an immunogen • Functions as an antibody • Main antibody isotope found in blood and fluids • Controls infections of body tissue • Rids the body of pathogens
IgG Antibodies • Most common and most important • Circulate in the blood and other body fluids • Defend against invading bacteria and viruses • Binding with antigens activates immune cells that engulf and destroy antigens • Moves easily across cell membrane
Amino Acid Sequence of IgG • 1 mkhlwfflllvaaprwvlsq vqlqesgpglvkpsetlsltctvsggsisshywswirqsp • 61 gkglqwigyiyysgstnysp slksrvtisvetsknqfslk ltsmtaadtavyycar
ITP(idiopathic thrombocytopenic purpura) • Body destroys the platelets as they are made while a typical, healthy platelet is circulates for 9-10 days • Can cause internal and external bleeding without injury • Symptoms- red dots on skin, large bruises, bleeding in gums
IgGuse for ITP • IVIG (intra venous immunoglobulin) is a treatment for ITP • The IgG antibody is used to neutralize the foreign objects such as ITP • IVIG is formed by taking IgG antibodies from 2o,ooo donors and mixing them together • Infusion IVIG has proven to be effective in immune deficiency disorder like ITP • IVIG supplies the antibodies for people who cannot make them
SITUATION • An ITP (idiopathic thrombocytopenic purpura) (low platelets) antigen is about to invade someone’s blood cells and cause them to have terrible virus for the rest of their life. First group to match all of the antibodies binding sites to the correct antigens stops the ITP antigen and gets a prize!
Websites • www.morphosys.com/technologies/antibodies/function • www.science.howstuffworks.com • ghr.nlm.nih.gov • www.scienceclarified.com • pathmicro.med.sc.edu • www.ncbi.nlm.nih.gov • www.itpanswers.com • www.nplate.com/patient/understanding-itp/symptoms • www.cidpusa.org/ivig.html