'Supplementary fig' presentation slideshows

Supplementary fig - PowerPoint PPT Presentation


Supplementary Fig. 1

Supplementary Fig. 1

Stage 1. Stage 2. Stage 3. Supplementary Fig. 1

By lois
(66 views)

Supplementary Fig . 1

Supplementary Fig . 1

Supplementary Fig . 1. a DF strain. b DHF strain. c DHF strain. Plasma dengue vRNA copies / ml ( log). Days post inoculation.

By shanna
(65 views)

Supplementary Fig. 1

Supplementary Fig. 1

Supplementary Fig. 1 Associations between TERT promoter mutations and typical genetic alterations in glial tumors . Abbreviations : PXA = pleomorphic xanthoastrocytoma ; A II = astrocytoma WHO grade II; A III = astrocytoma WHO grade III; LOH = loss of herterogeneity ;

By aysel
(121 views)

C70-Goody ball-65

C70-Goody ball-65

C268-Beltis. I. B2145-Ironman. B2145-Ironman. II. B2138-Marathon. C295-Atria. B2085-Green Belt. C33-Green Express. C70-Goody ball 65. B2198-Green Dome. C70-Goody ball-65. B2061-Fighter. B2198-Green Dome. C217-Ogane. C157-Blue Vantage. C217-Ogane. B2056-Heart Land.

By tirza
(140 views)

N-acetylmuramoyl-L-alanine amidase [Clostridium perfringens ATCC 13124]

N-acetylmuramoyl-L-alanine amidase [Clostridium perfringens ATCC 13124]

Supplementary Fig. 1. Amino acid sequence and predicted domains of the expressed protein. N-acetylmuramoyl-L-alanine amidase [Clostridium perfringens ATCC 13124] Sequence ID: ref|YP_696189.1| Length: 337 1 MKIAVRGGHNFKAKGALGIIDETIENRKVYKALIKYLNIAGHNVIDVTPGECDINTDLYL 60

By zariel
(110 views)

ACOT9 Phylogenetic tree

ACOT9 Phylogenetic tree

Supplementary Fig. 2. Mammals. Birds. ACOT9 Phylogenetic tree. Ray- finned fish. Inverte - brates. *. *. Insects. *. *. Plants. Bacteria. Fungi. *. *. Nematode.

By makala
(107 views)

BBWV-2

BBWV-2

Supplementary Fig. 3. b. a. mock. BBWV-2. inoculated leaf. mock. BBWV-2. upper leaf. c. inoculated leaf. mock. BBWV-2. mock. BBWV-2. d. mock. BBWV-2. inoculated leaf. upper leaf. mock. BBWV-2. upper leaf.

By brock
(114 views)

Supplementary Fig . 1

Supplementary Fig . 1

D. Molar. Incisor. ODB. *. *. *. *. ODB. b. a. Supplementary Fig . 1 . Osteopontin. BSP. DSP. B . B . B . Bone. a. b. c. D . D . D . Dentin. ODB . ODB . ODB . d. e. f. Supplementary Fig . 2 .

By mckile
(143 views)

Supplementary Fig. 1

Supplementary Fig. 1

mkk3DN. mkk6DN. control. –. +. SB202190. –/–. –/–. +/ –. +/ –. mkk7. –. –. –. UV. CycB1 k.a. GST-ATF2. CDC2. GST-c-Jun. CycD1 k.a. Actin. Mkk6DN. Cdk4. MKK3DN. +. +. +. a. Supplementary Fig. 1. b.

By medea
(71 views)

By keiji
(160 views)

Adult Liver

Adult Liver

Amino acid In vitro recapitulation of the urea cycle using murine embryonic stem cell  derived in vitro liver model Miho Tamai, Mami Aoki, Akihito Nishimura, Koji Morishita, and Yoh-ichi Tagawa *

By halil
(98 views)

Supplementary Fig 1

Supplementary Fig 1

Supplementary Fig 1. % cells with subG0/G1 DNA content. 0. 0. 0. 0. 90. 60. min. 90. 60. 90. 60. 90. 60. 120. 120. 120. 120. U937 Vector Control NPM-RAR NPM-RAR Clone 7 Clone 10.

By suchi
(66 views)

Supplementary Fig. 1

Supplementary Fig. 1

DraI. DraI. DraI. 4.3 kb. X. X. pta. als. ( ldhA als ). ldhA. Probe pta. DraI. DraI. Probe apr. X. X. apr. als. ( ldhA als pta ). ldhA. 6.3 kb. ( ldhA als pta ). ( ldhA als pta ). ( ldhA als ). ( ldhA als ). 6.3 kb. 4.3 kb. (Probe pta ). (Probe apr ).

By isaura
(58 views)

Supplementary Fig.1

Supplementary Fig.1

Supplementary Fig.1. Frozen sample. FFPE sample. AA045 IDH1 R132H. AO036 IDH1 R132H. GBM155 IDH1 wt.

By armen
(66 views)

Tetep

Tetep

Nipponbare. O . rufipogon. Grandiglumis. Caloro. HP2216. O. nivara. Tetep. O. rhizomatis. Bhrigudhan. K-60. Co-39. O . minuta. O. punctata. Jatto. O. latifolia. O . officinalis. 1bp. 500. 1000. 2000bp. 1500.

By elom
(135 views)

Supplementary Fig. S1.

Supplementary Fig. S1.

Supplementary Fig. S1. Supplementary Fig. S2. Supplementary Fig. S3. Supplementary Fig. S4.

By chaela
(66 views)

Supplementary Fig . 1

Supplementary Fig . 1

Supplementary Fig . 1. a. pGBM (154). AA (44). DA (17). 3. IDH. IDH. IDH. 1. 1. 1. 2. 1. 6. 23. TP53. 3. 1. 5. 40. 89. 3. 5. 10. TERT. TERT. TP53. TP53. TERT. None=6. None=10. None=5. All tumors ( 304 ). OL/AO/OA/AOA (83 ). IDH. TERT. 4. 98. 1. 15. 40. 4.

By kiara
(134 views)

Osmotin

Osmotin

Osmotin.

By xerxes
(129 views)

Actin

Actin

Supplementary Figure S1. Lee et al. PEA-15. Actin. Hey. 2774. RMG-1. KOC-7c. OVTOKO. OVCA420. OVCA432. SKOV3.ip1.

By fay
(137 views)

Supplementary Fig. 1

Supplementary Fig. 1

Supplementary Fig. 1. Supplementary Fig. 2. (a). (b). (c). PL1. PL1. PL2. PL2. PG (C 20 –C 20 ). PG (C 20 –C 20 ). PG (C 20 –C 25 ). PG (C 20 –C 25 ). PL3. PL3. PL4. PGL1. PL4. PGL1. PGL2. PGL1. PGP-ME. PGL2. PGL2. PGP-ME. PL5. PL6. PL5. PL6. PGL3. PGL3. PGL4. PGL4.

By gaurav
(61 views)

View Supplementary fig PowerPoint (PPT) presentations online in SlideServe. SlideServe has a very huge collection of Supplementary fig PowerPoint presentations. You can view or download Supplementary fig presentations for your school assignment or business presentation. Browse for the presentations on every topic that you want.