slide1
Download
Skip this Video
Download Presentation
On-site maintenance for industry

Loading in 2 Seconds...

play fullscreen
1 / 39

On-site maintenance for industry - PowerPoint PPT Presentation


  • 79 Views
  • Uploaded on

On-site maintenance for industry. Teollisuuden on-site kunnossapito. 1. Teollisuuden on-site kunnossapito. Valitse esityskokonaisuus. Laaja esitys. Katso osissa. takaisin. Teollisuuden on-site kunnossapito.

loader
I am the owner, or an agent authorized to act on behalf of the owner, of the copyrighted work described.
capcha
Download Presentation

PowerPoint Slideshow about 'On-site maintenance for industry' - ormand


An Image/Link below is provided (as is) to download presentation

Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author.While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server.


- - - - - - - - - - - - - - - - - - - - - - - - - - E N D - - - - - - - - - - - - - - - - - - - - - - - - - -
Presentation Transcript
slide1
On-site maintenance for industry

Teollisuuden on-site kunnossapito

1

slide2
Teollisuuden on-site kunnossapito

Valitse esityskokonaisuus

  • Laaja esitys
  • Katso osissa

takaisin

slide3
Teollisuuden on-site kunnossapito

IS-Technics Oy:n on-site laitteilla ja menetelmillä sekä osaavalla henkilöstöllä hoituvat kaikki teollisuuden kunnossapitotehtävät.

  • Toiminta
  • On-sitella vaivatonta säästöä
  • On-site koneistus
  • On-site pinnoitus
  • IS-Technics asentaa
  • IS-Technics suunnittelee ja valmistaa
  • On-site
  • Referenssiasiakkaita

takaisin

is technics oy on teollisuuden on site kunnossapitoon erikoistunut yritys
Teollisuuden on-site kunnossapitoIS-TECHNICS OY ON TEOLLISUUDEN ON-SITE KUNNOSSAPITOON ERIKOISTUNUT YRITYS

Teollisuuden, voimalaitosten ja energiatuotannon on-site kunnossapito sekä alan koneiden suunnittelu ja rakentaminen ovat yrityksemme päätoimialoja.

Henkilökuntamme edustaa on-site kunnossapidon alalla pitkäaikaista, monipuolista ja tehokasta osaamista. Lisäksi IS-yhtiöiden tuki ja lukuisat yhteistyösopimukset eri alojen osaajien kanssa antavat laajan pohjan monipuoliselle osaamisellemme.

Toimipaikaksemme olemme valinneet Suomesta mahdollisimman keskeisen paikan Mäntän, josta 250 km:n säteellä on Suomen teollisuudesta 90 prosenttia. Toimipaikalla varustelemme laitteemme jokaisen tilauksen vaatimalla yksilöidyllä tavalla. Verstaamme toimintaan kuuluu myös asiakkaillemme suunniteltujen koneiden ja laitteiden valmistus ja kokoonpano.

Toimimme ISO 9001 standardin mukaan.

Raimo Keskitalo

on sitella vaivatonta s st
Teollisuuden on-site kunnossapitoON-SITELLA VAIVATONTA SÄÄSTÖÄ

On-site kunnossapitoteknologia on järkevä tapa pitää kaikki teollisuuden koneet ja laitteet aina tuotantokunnossa. Se säästää asiakkaalta vaivaa, mutta ennen kaikkea aikaa ja rahaa.

Asiakkaan luona tehtävä on-site kunnossapito mahdollistaa tuotantolaitteiden ja koneiden korjaukset lähes ilman purku- ja kuljetusvaiheita. Näin säästetään tuotantoaikaa, sekä vältytään kalliilta kuljetus- ja seisonta-ajoilta.

Keskity omaan osaamiseesi – valitse vaivaton on-site kunnossapitopalvelu.

on site koneistus
Teollisuuden on-site kunnossapitoON-SITE KONEISTUS

Nykyisillä hallitsemillamme on-site menetelmillä on mahdollista suorittaa erittäin vaativiakin koneistustöitä asiakkaan luona työkohteessa todella kustannustehokkaasti. Säästöt tulevat asiakkaille toteutuksen helppouden ja tuotantoajan pidentymisen kautta.

Esimerkkejä voimalaitoksilla tapahtuvista on-site koneistuksista:

  • Voimalaitosten modifiointien ja vuosihuoltojen yhteydessä tehtävät koneistustyöt
  • Turbiinin sisäpesien sovituskoneistukset ulkopesiin
  • Roottorien ja turbiinien laakerien sorvaukset, aarporaukset ja hionnat
  • Jakotasojen korjaukset ja uritukset
  • Kytkinten reikien poraukset ja hoonaukset
  • Erilaiset venttiilien korjaukset ja hionnat
  • Pikasulkuventtiilien korien sovituskoneistukset
  • Laippojen oikaisukoneistukset
  • Lämmönvaihtimien kunnostukset
  • Koneiden ja pumppujen petien jyrsinnät
  • Esimerkkejä muista koneistusmahdollisuuksista
  • Erilaisten kuljettimien yms. akselitappien korjaussorvaukset ja kiilaurien jyrsinnät
  • Koneiden runkojen poraukset, kierteistykset sekä erilaisten konepetien ja tasojen koneistukset
  • Erilaisten telojen ja sylinterien sorvaukset ja hionnat
  • Putkistojen, nosturien yms. laippojen oikaisut
on site pinnoitus
Teollisuuden on-site kunnossapitoON-SITE PINNOITUS

Uusinta on-site tekniikkaa sovelletaan myös pinnoitusasioissa. Kuluneen vuoden aikana olemme kouluttaneet osaavaa henkilökuntaa myös erilaisten pinnoitusmenetelmien ja materiaalien hallintaan.

Uudenaikaisella kalustolla ja eri alojen osaajien kanssa tehtyjen palvelusopimuksien avulla pystymme vastaamaan asiakkaidemme vaativiinkin tarpeisiin.

Voimalaitosympäristössä on myös menestyksellisesti suoritettu pinnoituksia turbiinien kunnostuksien ja modifiointien yhteydessä sekä erilaisten eroosio- ja korroosio yms. syöpymien, jakotasojen sekä johtosiipien ja niiden kiinnitysurien korjauksissa. Kattiloiden ja putkistojen eroosio- ja korroosiokulumisien ehkäisyssä on myös hyvät kokemukset pinnoitteistamme.

  • Esimerkkejä pinnoitteista
  • Kitkaa parantavat pinnoitteet
  • Kulutusta kestävät pinnoitteet
  • Korroosion ja eroosion kestävät pinnoitteet
  • Kohteita
  • Kantotelat ja rullaussylinterit
  • Kokilli- ja puristintelat
  • Johtosiipien urat
  • Jakotasot
  • Jäähdytyssylinterit
  • Kattilat
on site asennus
Teollisuuden on-site kunnossapitoON-SITE ASENNUS

Asennustoimintamme keskittyy palvelemaan pääasiassa koneistukseen liittyvien purku- ja asennustöiden suorittamiseen, jolloin asiakas saa samalta toimittajalta kokonaisvaltaisen paketin kohteensa korjaamiseen ”avaimet käteen” -periaatteella.

Lisäksi räätälöimme asiakkaan tarpeen mukaisia konekohtaisia kunnossapito- ja huoltopaketteja.

is technics suunnittelee ja valmistaa
Teollisuuden on-site kunnossapitoIS-TECHNICS SUUNNITTELEE JA VALMISTAA

IS-Technics Oy:n vankkaa erikoisosaamista on myös alan koneiden ja laitteiden suunnittelu ja valmistus.

Vuosikymmenten kokemus teollisuuden koneista ja laitteista on tuonut tietotaitoa ja näkemystä konesuunnitteluun.

Vain käytännön tuoma tietämys alan koneista voi johtaa toimivien kokonaisuuksien hallintaan. Juuri nämä ominaisuudet ovat nostaneet IS-Technics Oy:n konesuunnittelun kärkikaartiin.

Asiantuntevan suunnittelun jatkeena on oltava myös osaava toteutus.

IS-Technics Oy takaa koneiden toimivuuden asiakkaan toivomalla tavalla. Verstaamme toimintaan kuuluu myös asiakkaillemme suunniteltujen koneiden ja laitteiden valmistus ja kokoonpano.

referenssit
Teollisuuden on-site kunnossapitoREFERENSSIT

Pitkällä, yli 20 vuodenkokemuksellammepystymmepalvelemaanasiakkaitammetodellavaativissakinkunnossapitotöissä.

On-site asiakkaitamme

Meillä on myöslukuisiaulkomaankohteitalaitetoimittajienkautta mm. Venäjällä, Kiinassa, Indonesiassa, Intiassaja EU-maissa.

FortumLoviisanvoimalaitos

HelsinginEnergiaOy

TampereenKaupunginSähkölaitosOy

TeollisuudenVoimaOy

Siemens Oy

Metsä-BotniaOyRauma

Georgia Pacific Nordic Oy

M-real

UPM-paperitehtaat

Stora Enso

NokianRenkaatOyj

PikoteknikOy/Voith

TeknikumOyVammala

Runtech Systems Ltd

RaflatacOy

WellquipOy

slide12
Teollisuuden on-site kunnossapito

Valitse esityskokonaisuus

  • Laaja esitys
  • Katso osissa

takaisin

is technics oy on teollisuuden on site kunnossapitoon erikoistunut yritys13
Teollisuuden on-site kunnossapitoIS-TECHNICS OY ON TEOLLISUUDEN ON-SITE KUNNOSSAPITOON ERIKOISTUNUT YRITYS

Teollisuuden, voimalaitosten ja energiatuotannon on-site kunnossapito sekä alan koneiden suunnittelu ja rakentaminen ovat yrityksemme päätoimialoja.

Henkilökuntamme edustaa on-site kunnossapidon alalla pitkäaikaista, monipuolista ja tehokasta osaamista. Lisäksi IS-yhtiöiden tuki ja lukuisat yhteistyösopimukset eri alojen osaajien kanssa antavat laajan pohjan monipuoliselle osaamisellemme.

Toimipaikaksemme olemme valinneet Suomesta mahdollisimman keskeisen paikan Mäntän, josta 250 km:n säteellä on Suomen teollisuudesta 90 prosenttia. Toimipaikalla varustelemme laitteemme jokaisen tilauksen vaatimalla yksilöidyllä tavalla. Verstaamme toimintaan kuuluu myös asiakkaillemme suunniteltujen koneiden ja laitteiden valmistus ja kokoonpano.

Toimimme ISO 9001 standardin mukaan.

Raimo Keskitalo

seuraava

takaisin

on sitella vaivatonta s st14
Teollisuuden on-site kunnossapitoON-SITELLA VAIVATONTA SÄÄSTÖÄ

On-site kunnossapitoteknologia on järkevä tapa pitää kaikki teollisuuden koneet ja laitteet aina tuotantokunnossa. Se säästää asiakkaalta vaivaa, mutta ennen kaikkea aikaa ja rahaa.

Asiakkaan luona tehtävä on-site kunnossapito mahdollistaa tuotantolaitteiden ja koneiden korjaukset lähes ilman purku- ja kuljetusvaiheita. Näin säästetään tuotantoaikaa, sekä vältytään kalliilta kuljetus- ja seisonta-ajoilta.

Keskity omaan osaamiseesi – valitse vaivaton on-site kunnossapitopalvelu.

seuraava

takaisin

on site koneistus15
Teollisuuden on-site kunnossapitoON-SITE KONEISTUS

Nykyisillä hallitsemillamme on-site menetelmillä on mahdollista suorittaa erittäin vaativiakin koneistustöitä asiakkaan luona työkohteessa todella kustannustehokkaasti. Säästöt tulevat asiakkaille toteutuksen helppouden ja tuotantoajan pidentymisen kautta.

Esimerkkejä voimalaitoksilla tapahtuvista on-site koneistuksista:

  • Voimalaitosten modifiointien ja vuosihuoltojen yhteydessä tehtävät koneistustyöt
  • Turbiinin sisäpesien sovituskoneistukset ulkopesiin
  • Roottorien ja turbiinien laakerien sorvaukset, aarporaukset ja hionnat
  • Jakotasojen korjaukset ja uritukset
  • Kytkinten reikien poraukset ja hoonaukset
  • Erilaiset venttiilien korjaukset ja hionnat
  • Pikasulkuventtiilien korien sovituskoneistukset
  • Laippojen oikaisukoneistukset
  • Lämmönvaihtimien kunnostukset
  • Koneiden ja pumppujen petien jyrsinnät
  • Esimerkkejä muista koneistusmahdollisuuksista
  • Erilaisten kuljettimien yms. akselitappien korjaussorvaukset ja kiilaurien jyrsinnät
  • Koneiden runkojen poraukset, kierteistykset sekä erilaisten konepetien ja tasojen koneistukset
  • Erilaisten telojen ja sylinterien sorvaukset ja hionnat
  • Putkistojen, nosturien yms. laippojen oikaisut

seuraava

takaisin

on site pinnoitus16
Teollisuuden on-site kunnossapitoON-SITE PINNOITUS

Uusinta on-site tekniikkaa sovelletaan myös pinnoitusasioissa. Kuluneen vuoden aikana olemme kouluttaneet osaavaa henkilökuntaa myös erilaisten pinnoitusmenetelmien ja materiaalien hallintaan.

Uudenaikaisella kalustolla ja eri alojen osaajien kanssa tehtyjen palvelusopimuksien avulla pystymme vastaamaan asiakkaidemme vaativiinkin tarpeisiin.

Voimalaitosympäristössä on myös menestyksellisesti suoritettu pinnoituksia turbiinien kunnostuksien ja modifiointien yhteydessä sekä erilaisten eroosio- ja korroosio yms. syöpymien, jakotasojen sekä johtosiipien ja niiden kiinnitysurien korjauksissa. Kattiloiden ja putkistojen eroosio- ja korroosiokulumisien ehkäisyssä on myös hyvät kokemukset pinnoitteistamme.

  • Esimerkkejä pinnoitteista
  • Kitkaa parantavat pinnoitteet
  • Kulutusta kestävät pinnoitteet
  • Korroosion ja eroosion kestävät pinnoitteet
  • Kohteita
  • Kantotelat ja rullaussylinterit
  • Kokilli- ja puristintelat
  • Johtosiipien urat
  • Jakotasot
  • Jäähdytyssylinterit
  • Kattilat

seuraava

takaisin

on site asennus17
Teollisuuden on-site kunnossapitoON-SITE ASENNUS

Asennustoimintamme keskittyy palvelemaan pääasiassa koneistukseen liittyvien purku- ja asennustöiden suorittamiseen, jolloin asiakas saa samalta toimittajalta kokonaisvaltaisen paketin kohteensa korjaamiseen ”avaimet käteen” -periaatteella.

Lisäksi räätälöimme asiakkaan tarpeen mukaisia konekohtaisia kunnossapito- ja huoltopaketteja.

seuraava

takaisin

is technics suunnittelee ja valmistaa18
Teollisuuden on-site kunnossapitoIS-TECHNICS SUUNNITTELEE JA VALMISTAA

IS-Technics Oy:n vankkaa erikoisosaamista on myös alan koneiden ja laitteiden suunnittelu ja valmistus.

Vuosikymmenten kokemus teollisuuden koneista ja laitteista on tuonut tietotaitoa ja näkemystä konesuunnitteluun.

Vain käytännön tuoma tietämys alan koneista voi johtaa toimivien kokonaisuuksien hallintaan. Juuri nämä ominaisuudet ovat nostaneet IS-Technics Oy:n konesuunnittelun kärkikaartiin.

Asiantuntevan suunnittelun jatkeena on oltava myös osaava toteutus.

IS-Technics Oy takaa koneiden toimivuuden asiakkaan toivomalla tavalla. Verstaamme toimintaan kuuluu myös asiakkaillemme suunniteltujen koneiden ja laitteiden valmistus ja kokoonpano.

seuraava

takaisin

referenssit20
Teollisuuden on-site kunnossapitoREFERENSSIT

Pitkällä, yli 20 vuoden kokemuksellamme pystymme palvelemaan asiakkaitamme todella vaativissakin kunnossapitotöissä.

On-site asiakkaitamme

Meillä on myös lukuisia ulkomaan kohteita laitetoimittajien kautta mm. Venäjällä, Kiinassa, Indonesiassa, Intiassa ja EU-maissa.

FortumLoviisanvoimalaitos

HelsinginEnergiaOy

TampereenKaupunginSähkölaitosOy

TeollisuudenVoimaOy

Siemens Oy

Metsä-BotniaOyRauma

Georgia Pacific Nordic Oy

M-real

UPM-paperitehtaat

Stora Enso

NokianRenkaatOyj

PikoteknikOy/Voith

TeknikumOyVammala

Runtech Systems Ltd

RaflatacOy

WellquipOy

seuraava

takaisin

slide21
On-site maintenance for industry

Choose a presentation

  • Complete
  • View in sections

back

slide22
On-site maintenance for industry

All tasks related to industrial maintenance and repair will be accomplished with IS-Technics Ltd on-site techniques, equipment and trained personnel.

  • Operation
  • Save with on-site service
  • On-site machining
  • On-site coating
  • IS-Technics assembles
  • IS-Technics designs and manufactures
  • On-site
  • References

back

is technics ltd a company specializing in on site maintenance
On-site maintenance for industryIS-TECHNICS LTD – A COMPANY SPECIALIZING IN ON-SITE MAINTENANCE

IS-Technics Ltd is a company specializing in on-site maintenance and repairs in industry, power plants, and energy production and in design and construction of related machines.

Our personnel has long-term, versatile and efficient experience in the field of on-site maintenance. In addition, we have the support of other IS-companies and numerous co-operative contracts with professionals in many special sectors which provide a wide range of professional skills.

For our business, we have chosen as central a place as possible in Finland. Our company is located in Mänttä, which is within 250 kilometres of 90 percent of Finnish industry. We customize each order for the individual. Our workshop operations also contain manufacturing and composition of machines and appliances designed for our customers.

We comply with ISO 9001 standard.

Raimo Keskitalo

it s easy to save with on site service
On-site maintenance for industryIT’S EASY TO SAVE WITH ON-SITE SERVICE

Using on-site maintenance technology is a good way to keep industrial machines and devices in working order. It saves customers' time and reduces their work and expenses.

On-site maintenance that is accomplished at the customer's location, enables repair work of production equipment and machines without major demolition work or transportation. This saves time for production and decreases additional conveyance time and costs.

Concentrate on your own craftsmanship - choose easy on-site maintenance service.

on site machining
On-site maintenance for industryON-SITE MACHINING

Our present-day on-site methods also make it possible to accomplish exceptionally demanding machining tasks at the customer's location in a very cost-effective manner. Expenses are reduced by ease of completion and through uninterrupted production periods.

Examples of on-site mechanizing in power plants

  • Machining work in connection with modifications and annual surveys of power plants
  • Adjustment tooling of the inner casings of turbines into the outer casings
  • Lathe operation, reaming and grinding of the bearings of rotors and turbines
  • Amendment and grooving of distribution planes
  • Drilling and honing of coupler holes miscellaneous amendment and grinding operations of valves
  • Adjustment tooling of the bodywork of high speed check valves
  • Straightening machining of flanges
  • Maintenance of thermal exchangers
  • Milling the beds of machines and pumps
  • Examples of other possible mechanizing alternatives
  • Repairing lathe operation of the stub axles and keyway milling in varying carriages etc.
  • Drilling and threading of machine frameworks
  • Mechanizing of diverse machine beds and planes
  • Lathe operation and grinding of diverse rollers and cylinders
  • Straightening the flanges of pipeworks, cranes, etc.
on site coating
On-site maintenance for industryON-SITE COATING

The newest on-site technology is also applied to the domain of coating. We have trained skilled coaters to master diverse methods and materials.

We are capable of satisfying our customers' demanding needs due to our up-to-date equipment and professional service contracts.

We have also successfully accomplished coating operations in power plants in connection with reconditioning and modification of turbines and repair (e.g. corrosion, distributor planes, leading wings and their retaining slots). We have also had good results in preventing erosion and corrosion in boilers and pipeworks with our coatings.

  • Example objects to be coated
  • king rolls
  • reeling drums chilled rolls
  • pressure cylinders
  • cooling cylinders
  • Examples of coatings
  • friction improvable coatings
  • abrasion resistant coatings
  • corrosion- and erosion proof coatings
  • distributor planes
  • leading wing slots boilers
is technics assembles
On-site maintenance for industryIS-TECHNICS ASSEMBLES

Our assembly operation concentrates mainly on accomplishing machining related installations and disassembly tasks. As a result, the supplier provides an integrated service packet for the customer on a turn-key principle.

In addition, we customize proprietary maintenance- and upkeep packets for machines in accordance with the customer's needs.

is technics designs and manufactures
On-site maintenance for industryIS-TECHNICS DESIGNS AND MANUFACTURES

IS-Technics Ltd also specializes in planning and construction of industrial machines and devices. In addition to several decades of experience on these devices, we also have a good deal of know-how and vision involving machine designing.

Our company’s years of experience has given us the ability to master massive systems and keep them functional. These qualities have helped promote IS-Technics Ltd to an elite class among machine developers.

Professional planning must be followed by competent delivery. IS-Technics Ltd guarantees that the machines we service will work the way the customer requests. In addition, our workshop manufactures and assembles machines and devices designed for our customers.

on site operations model we comply with the iso 9001 standard
On-site maintenance for industryON-SITE OPERATIONS MODELWe comply with the ISO 9001 standard

The customer contacts the professional team of IS-Technics.

An introductory meeting at the customer's location.

IS-Technics outlines the process and the timetable.

An on-site maintenance team arrives to accomplish the task.

IS-Technics Ltd

Louhimontie 12

35800 Mänttä, Finland

Tel. +358 3 4711 100

Fax. +358 3 4711 150

www.is-technics.fi

The team completes the work agreed to.

Using on-site services saves time and money.

Mission completed - on time.

reference clients
On-site maintenance for industryREFERENCE CLIENTS

With over 20 years of experience we are able to accomplish extremely demanding maintenance and repair tasks.

Our on-site clients

We have several foreign clients for example in Russia, China, India and Europe.

  • FortumLoviisa power plant
  • Helsinki Energy
  • Tampere Power Utility
  • Industrial Power Inc.
  • Siemens Ltd
  • OyMetsä-BotniaAbRauma
  • Georgia-Pacific Nordic Oy
  • M-real
  • UPM-paper factories
  • Stora Enso
  • NokianTyres plc
  • PikoteknikOy/Voith
  • TeknikumOyVammala
  • Runtech Systems Ltd
  • Raflatac Ltd
  • WellquipOy
slide31
On-site maintenance for industry

Choose a presentation

  • Complete
  • View in sections

back

is technics ltd a company specializing in on site maintenance32
On-site maintenance for industryIS-TECHNICS LTD – A COMPANY SPECIALIZING IN ON-SITE MAINTENANCE

IS-Technics Ltd is a company specializing in on-site maintenance and repairs in industry, power plants, and energy production and in design and construction of related machines.

Our personnel has long-term, versatile and efficient experience in the field of on-site maintenance. In addition, we have the support of other IS-companies and numerous co-operative contracts with professionals in many special sectors which provide a wide range of professional skills.

For our business, we have chosen as central a place as possible in Finland. Our company is located in Mänttä, which is within 250 kilometres of 90 percent of Finnish industry. We customize each order for the individual. Our workshop operations also contain manufacturing and composition of machines and appliances designed for our customers.

We comply with ISO 9001 standard.

Raimo Keskitalo

next

back

it s easy to save with on site service33
On-site maintenance for industryIT’S EASY TO SAVE WITH ON-SITE SERVICE

Using on-site maintenance technology is a good way to keep industrial machines and devices in working order. It saves customers' time and reduces their work and expenses.

On-site maintenance that is accomplished at the customer's location, enables repair work of production equipment and machines without major demolition work or transportation. This saves time for production and decreases additional conveyance time and costs.

Concentrate on your own craftsmanship - choose easy on-site maintenance service.

next

back

on site machining34
On-site maintenance for industryON-SITE MACHINING

Our present-day on-site methods also make it possible to accomplish exceptionally demanding machining tasks at the customer's location in a very cost-effective manner. Expenses are reduced by ease of completion and through uninterrupted production periods.

Examples of on-site mechanizing in power plants

  • Machining work in connection with modifications and annual surveys of power plants
  • Adjustment tooling of the inner casings of turbines into the outer casings
  • Lathe operation, reaming and grinding of the bearings of rotors and turbines
  • Amendment and grooving of distribution planes
  • Drilling and honing of coupler holes miscellaneous amendment- and grinding operations of valves
  • Adjustment tooling of the bodywork of high speed check valves
  • Straightening machining of flanges
  • Maintenance of thermal exchangers
  • Milling the beds of machines and pumps
  • Examples of other possible mechanizing alternatives
  • Repairing lathe operation of the stub axles and keyway milling in varying carriages etc.
  • Drilling and threading of machine frameworks
  • Mechanizing of diverse machine beds and planes
  • Lathe operation and grinding of diverse rollers and cylinders
  • Straightening the flanges of pipeworks, cranes, etc.

next

back

on site coating35
On-site maintenance for industryON-SITE COATING

The newest on-site technology is also applied to the domain of coating. We have trained skilled coaters to master diverse methods and materials.

We are capable of satisfying our customers' demanding needs due to our up-to-date equipment and professional service contracts.

We have also successfully accomplished coating operations in power plants in connection with reconditioning and modification of turbines and repair (e.g. corrosion, distributor planes, leading wings and their retaining slots). We have also had good results in preventing erosion and corrosion in boilers and pipeworks with our coatings.

  • Example objects to be coated
  • king rolls
  • reeling drums chilled rolls
  • pressure cylinders
  • cooling cylinders
  • Examples of coatings
  • friction improvable coatings
  • abrasion resistant coatings
  • corrosion- and erosion proof coatings
  • distributor planes
  • leading wing slots boilers

next

back

is technics assembles36
On-site maintenance for industryIS-TECHNICS ASSEMBLES

Our assembly operation concentrates mainly on accomplishing machining related installations and disassembly tasks. As a result, the supplier provides an integrated service packet for the customer on a turn-key principle.

In addition, we customize proprietary maintenance- and upkeep packets for machines in accordance with the customer's needs.

next

back

is technics designs and manufactures37
On-site maintenance for industryIS-TECHNICS DESIGNS AND MANUFACTURES

IS-Technics Ltd also specializes in planning and construction of industrial machines and devices. In addition to several decades of experience on these devices, we also have a good deal of know-how and vision involving machine designing.

Our company’s years of experience has given us the ability to master massive systems and keep them functional. These qualities have helped promote IS-Technics Ltd to an elite class among machine developers.

Professional planning must be followed by competent delivery. IS-Technics Ltd guarantees that the machines we service will work the way the customer requests. In addition, our workshop manufactures and assembles machines and devices designed for our customers.

next

back

on site operations model we comply with the iso 9001 standard38
On-site maintenance for industryON-SITE OPERATIONS MODELWe comply with the ISO 9001 standard

next

back

The customer contacts the professional team of IS-Technics.

An introductory meeting at the customer's location.

IS-Technics outlines the process and the timetable.

An on-site maintenance team arrives to accomplish the task.

IS-Technics Ltd

Louhimontie 12

35800 Mänttä, Finland

Tel. +358 3 4711 100

Fax. +358 3 4711 150

www.is-technics.fi

The team completes the work agreed to.

Using on-site services saves time and money.

Mission completed - on time.

reference clients39
back

On-site maintenance for industry

REFERENCE CLIENTS

With over 20 years of experience we are able to accomplish extremely demanding maintenance and repair tasks.

Our on-site clients

We have several foreign clients for example in Russia, China, India and Europe.

  • FortumLoviisa power plant
  • Helsinki Energy
  • Tampere Power Utility
  • Industrial Power Inc.
  • Siemens Ltd
  • OyMetsä-BotniaAbRauma
  • Georgia-Pacific Nordic Oy
  • M-real
  • UPM-paper factories
  • Stora Enso
  • NokianTyres plc
  • PikoteknikOy/Voith
  • TeknikumOyVammala
  • Runtech Systems Ltd
  • Raflatac Ltd
  • WellquipOy

next

ad